PDB entry 3jyi

View 3jyi on RCSB PDB site
Description: Structural and biochemical evidence that a TEM-1 {beta}-lactamase Asn170Gly active site mutant acts via substrate-assisted catalysis
Class: hydrolase
Keywords: Beta-lactamase, Enzyme, antibiotic resistance, Disulfide bond, Hydrolase, Plasmid, Transposable element
Deposited on 2009-09-21, released 2009-10-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-12-15, with a file datestamp of 2009-12-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.231
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli [TaxId:562]
    Gene: bla, blaT-3, blaT-4, blaT-5, blaT-6, TEM-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-262)
      • engineered (144)
    Domains in SCOPe 2.06: d3jyia_
  • Chain 'B':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli [TaxId:562]
    Gene: bla, blaT-3, blaT-4, blaT-5, blaT-6, TEM-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-262)
      • engineered (144)
    Domains in SCOPe 2.06: d3jyib_
  • Chain 'C':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli [TaxId:562]
    Gene: bla, blaT-3, blaT-4, blaT-5, blaT-6, TEM-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-262)
      • engineered (144)
    Domains in SCOPe 2.06: d3jyic_
  • Chain 'D':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli [TaxId:562]
    Gene: bla, blaT-3, blaT-4, blaT-5, blaT-6, TEM-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-262)
      • engineered (144)
    Domains in SCOPe 2.06: d3jyid_
  • Chain 'E':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli [TaxId:562]
    Gene: bla, blaT-3, blaT-4, blaT-5, blaT-6, TEM-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-262)
      • engineered (144)
    Domains in SCOPe 2.06: d3jyie_
  • Chain 'F':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli [TaxId:562]
    Gene: bla, blaT-3, blaT-4, blaT-5, blaT-6, TEM-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-262)
      • engineered (144)
    Domains in SCOPe 2.06: d3jyif_
  • Heterogens: EPE, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jyiA (A:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelgeaipnderdttmpaamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jyiB (B:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelgeaipnderdttmpaamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jyiC (C:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelgeaipnderdttmpaamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jyiD (D:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelgeaipnderdttmpaamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jyiE (E:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelgeaipnderdttmpaamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jyiF (F:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelgeaipnderdttmpaamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw