PDB entry 3jx7

View 3jx7 on RCSB PDB site
Description: Bacillus cereus alkylpurine DNA glycosylase AlkD bound to DNA containing a 3-METHYLADENINE analog
Class: hydrolase/DNA
Keywords: HEAT repeat, DNA binding, DNA glycosylase, DNA alkylation, lyase-DNA COMPLEX, HYDROLASE-DNA COMPLEX
Deposited on 2009-09-18, released 2010-09-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.16
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkylpurine DNA Glycosylase AlkD
    Species: Bacillus cereus [TaxId:222523]
    Gene: AlkD, BC_4913
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q816E8 (1-231)
      • expression tag (0)
    Domains in SCOPe 2.04: d3jx7a_
  • Chain 'B':
    Compound: DNA (5'-d(*cp*gp*gp*ap*cp*tp*(dzm)p*ap*cp*gp*gp*g)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*cp*cp*cp*gp*tp*tp*ap*gp*tp*cp*cp*g)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jx7A (A:)
    pmhpfvkalqehftahqnpekaepmarymknhflflgiqtperrqllkdiiqihtlpdqk
    dfqiiirelwdlperefqaaaldimqkykkhinethipfleelivtkswwdsvdsivptf
    lgdiflkhpelisayipkwiasdniwlqraailfqlkykqkmdeellfwiigqlhsskef
    fiqkaigwvlreyaktnpdvvweyvqnnelaplskreaikhikqnyginnek
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.