PDB entry 3jw8

View 3jw8 on RCSB PDB site
Description: Crystal structure of human mono-glyceride lipase
Class: hydrolase
Keywords: alpha-beta hydrolase, HYDROLASE
Deposited on 2009-09-18, released 2010-01-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.157
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MGLL protein
    Species: Homo sapiens [TaxId:9606]
    Gene: MGLL, hCG_40840
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3jw8a_
  • Chain 'B':
    Compound: MGLL protein
    Species: Homo sapiens [TaxId:9606]
    Gene: MGLL, hCG_40840
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3jw8b_
  • Heterogens: MPD, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jw8A (A:)
    mhhhhhhmetgpedpssmpeessprrtpqsipyqdlphlvnadgqylfcrywkptgtpka
    lifvshgagehsgryeelarmlmgldllvfahdhvghgqsegermvvsdfhvfvrdvlqh
    vdsmqkdypglpvfllghsmggaiailtaaerpghfagmvlisplvlanpesattfkvla
    akvlnlvlpnlslgpidssvlsrnktevdiynsdplicraglkvcfgiqllnavsrvera
    lpkltvpflllqgsadrlcdskgayllmelaksqdktlkiyegayhvlhkelpevtnsvf
    heinmwvsqrtatagtaspp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jw8A (A:)
    sprrtpqsipyqdlphlvnadgqylfcrywkptgtpkalifvshgagehsgryeelarml
    mgldllvfahdhvghgqsegermvvsdfhvfvrdvlqhvdsmqkdypglpvfllghsmgg
    aiailtaaerpghfagmvlisplvlanpesattfkvlaakvlnlvlpnlslgpidssvls
    rnktevdiynsdplicraglkvcfgiqllnavsrveralpkltvpflllqgsadrlcdsk
    gayllmelaksqdktlkiyegayhvlhkelpevtnsvfheinmwvsqrta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3jw8B (B:)
    mhhhhhhmetgpedpssmpeessprrtpqsipyqdlphlvnadgqylfcrywkptgtpka
    lifvshgagehsgryeelarmlmgldllvfahdhvghgqsegermvvsdfhvfvrdvlqh
    vdsmqkdypglpvfllghsmggaiailtaaerpghfagmvlisplvlanpesattfkvla
    akvlnlvlpnlslgpidssvlsrnktevdiynsdplicraglkvcfgiqllnavsrvera
    lpkltvpflllqgsadrlcdskgayllmelaksqdktlkiyegayhvlhkelpevtnsvf
    heinmwvsqrtatagtaspp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jw8B (B:)
    dlphlvnadgqylfcrywkptgtpkalifvshgagehsgryeelarmlmgldllvfahdh
    vghgqsegermvvsdfhvfvrdvlqhvdsmqkdypglpvfllghsmggaiailtaaerpg
    hfagmvlisplvlanpesattfkvlaakvlnlvlpnlslgpidssvlsrnktevdiynsd
    plicraglkvcfgiqllnavsrveralpkltvpflllqgsadrlcdskgayllmelaksq
    dktlkiyegayhvlhkelpevtnsvfheinmwvsqrta