PDB entry 3jw4

View 3jw4 on RCSB PDB site
Description: The structure of a putative MarR family transcriptional regulator from Clostridium acetobutylicum
Class: Transcription regulator
Keywords: MarR, emrR, transcriptional regulator, DNA-binding protein, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, DNA-binding, Transcription, Transcription regulation, Transcription regulator
Deposited on 2009-09-17, released 2009-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.203
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, MarR/EmrR family
    Species: Clostridium acetobutylicum [TaxId:1488]
    Gene: CAC2486, CA_C2486
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jw4a_
  • Chain 'B':
    Compound: Transcriptional regulator, MarR/EmrR family
    Species: Clostridium acetobutylicum [TaxId:1488]
    Gene: CAC2486, CA_C2486
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jw4b_
  • Chain 'C':
    Compound: Transcriptional regulator, MarR/EmrR family
    Species: Clostridium acetobutylicum [TaxId:1488]
    Gene: CAC2486, CA_C2486
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jw4c_
  • Heterogens: K, GOL, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jw4A (A:)
    snamkesnhlmdtpysylirsigmklktsadarlaelglnsqqgrmigyiyenqesgiiq
    kdlaqffgrrgasitsmlqglekkgyierripennarqkniyvlpkgaalveefnnifle
    veesitkgltkdeqkqlmsilikvnrsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jw4A (A:)
    dtpysylirsigmklktsadarlaelglnsqqgrmigyiyenqesgiiqkdlaqfsitsm
    lqglekkgyierrkniyvlpkgaalveefnnifleveesitkgltkdeqkqlmsilikvn
    rsm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3jw4B (B:)
    snamkesnhlmdtpysylirsigmklktsadarlaelglnsqqgrmigyiyenqesgiiq
    kdlaqffgrrgasitsmlqglekkgyierripennarqkniyvlpkgaalveefnnifle
    veesitkgltkdeqkqlmsilikvnrsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jw4B (B:)
    lmdtpysylirsigmklktsadarlaelglnsqqgrmigyiyenqesgiiqkdlaqasit
    smlqglekkgyierripqkniyvlpkgaalveefnnifleveesitkgltkdeqkqlmsi
    likvnrsm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3jw4C (C:)
    snamkesnhlmdtpysylirsigmklktsadarlaelglnsqqgrmigyiyenqesgiiq
    kdlaqffgrrgasitsmlqglekkgyierripennarqkniyvlpkgaalveefnnifle
    veesitkgltkdeqkqlmsilikvnrsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jw4C (C:)
    dtpysylirsigmklktsadarlaelglnsqqgrmigyiyenqesgiiqkdlaqffgasi
    tsmlqglekkgyierriprqkniyvlpkgaalveefnnifleveesitkgltkdeqkqlm
    silikvnrsm