PDB entry 3jv4

View 3jv4 on RCSB PDB site
Description: Crystal structure of the dimerization domains p50 and RelB
Class: transcription
Keywords: NF-kB protein, Heterodimer, RelB and p50, Activator, Nucleus, Phosphoprotein, Transcription, Transcription regulation, ANK repeat, Apoptosis, DNA-binding, S-nitrosylation
Deposited on 2009-09-15, released 2010-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.225
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor relb
    Species: Mus musculus [TaxId:10090]
    Gene: Relb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jv4a_
  • Chain 'B':
    Compound: Nuclear factor NF-kappa-B p105 subunit
    Species: Mus musculus [TaxId:10090]
    Gene: p50
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jv4b_
  • Chain 'C':
    Compound: transcription factor relb
    Species: Mus musculus [TaxId:10090]
    Gene: Relb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jv4c_
  • Chain 'D':
    Compound: Nuclear factor NF-kappa-B p105 subunit
    Species: Mus musculus [TaxId:10090]
    Gene: p50
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jv4d_
  • Chain 'E':
    Compound: transcription factor relb
    Species: Mus musculus [TaxId:10090]
    Gene: Relb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jv4e_
  • Chain 'F':
    Compound: Nuclear factor NF-kappa-B p105 subunit
    Species: Mus musculus [TaxId:10090]
    Gene: p50
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jv4f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jv4A (A:)
    tselricrinkesgpctggeelyllcdkvqkedisvvfstaswegradfsqadvhrqiai
    vfktppyedleisepvtvnvflqrltdgvcseplpftylpr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jv4B (B:)
    asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
    rqfaivfktpkykdvnitkpasvfvqlrrksdletsepkpflyypeikdkeevqr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jv4C (C:)
    tselricrinkesgpctggeelyllcdkvqkedisvvfstaswegradfsqadvhrqiai
    vfktppyedleisepvtvnvflqrltdgvcseplpftylpr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jv4D (D:)
    asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
    rqfaivfktpkykdvnitkpasvfvqlrrksdletsepkpflyypeikdkeevqr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jv4E (E:)
    tselricrinkesgpctggeelyllcdkvqkedisvvfstaswegradfsqadvhrqiai
    vfktppyedleisepvtvnvflqrltdgvcseplpftylpr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3jv4F (F:)
    asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
    rqfaivfktpkykdvnitkpasvfvqlrrksdletsepkpflyypeikdkeevqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jv4F (F:)
    asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
    rqfaivfktpkykdvnitkpasvfvqlrrksdletsepkpflyypeikdkee