PDB entry 3jth

View 3jth on RCSB PDB site
Description: Crystal structure of a transcriptional regulator HlyU from Vibrio vulnificus CMCP6
Class: transcription
Keywords: transcription factor, HlyU, rtxA, DNA-binding, Transcription, Transcription regulation
Deposited on 2009-09-12, released 2010-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-16, with a file datestamp of 2010-03-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.231
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription activator HlyU
    Species: Vibrio vulnificus [TaxId:216895]
    Gene: VV1_0512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3jtha_
  • Chain 'B':
    Compound: Transcription activator HlyU
    Species: Vibrio vulnificus [TaxId:216895]
    Gene: VV1_0512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3jthb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jthA (A:)
    mnlkdmeqnsakavvllkamanerrlqilcmlhnqelsvgelcaklqlsqsalsqhlawl
    rrdglvttrkeaqtvyytlkseevkamikllhslycee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jthA (A:)
    mnlkdmeqnsakavvllkamanerrlqilcmlhnqelsvgelcaklqlsqsalsqhlawl
    rrdglvttrkeaqtvyytlkseevkamikllhslyc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3jthB (B:)
    mnlkdmeqnsakavvllkamanerrlqilcmlhnqelsvgelcaklqlsqsalsqhlawl
    rrdglvttrkeaqtvyytlkseevkamikllhslycee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jthB (B:)
    dmeqnsakavvllkamanerrlqilcmlhnqelsvgelcaklqlsqsalsqhlawlrrdg
    lvttrkeaqtvyytlkseevkamikllhslyc