PDB entry 3jte

View 3jte on RCSB PDB site
Description: Crystal structure of response regulator receiver domain Protein from clostridium thermocellum
Class: protein binding
Keywords: Structural genomics, NYSGRC, RESPONSE REGULATOR RECEIVER DOMAIN, target 11226e, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, PROTEIN BINDING
Deposited on 2009-09-11, released 2009-09-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.226
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator receiver protein
    Species: Clostridium thermocellum ATCC 27405 [TaxId:203119]
    Gene: Cthe_0583
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3DCZ0 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.04: d3jtea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jteA (A:)
    mslakilviddestilqnikflleidgnevltasssteglriftencnsidvvitdmkmp
    klsgmdilreikkitphmaviiltghgdldnailamkegafeylrkpvtaqdlsiainna
    inrkkllmenermtqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jteA (A:)
    lakilviddestilqnikflleidgnevltasssteglriftencnsidvvitdmkmpkl
    sgmdilreikkitphmaviiltghgdldnailamkegafeylrkpvtaqdlsiainnain
    rkkllm