PDB entry 3jtc

View 3jtc on RCSB PDB site
Description: Importance of Mg2+ in the Ca2+-Dependent Folding of the gamma-Carboxyglutamic Acid Domains of Vitamin K-Dependent clotting and anticlotting Proteins
Class: blood clotting
Keywords: GLA (gamma-carboxyglutamic acid) residues, phospholipid binding groove, Ca ion binding, blood clotting, Blood coagulation, Disulfide bond, Glycoprotein, Membrane, Receptor, Transmembrane, Cleavage on pair of basic residues, Disease mutation, EGF-like domain, Gamma-carboxyglutamic acid, Hydrolase, Hydroxylation, Protease, Serine protease, Thrombophilia, Zymogen
Deposited on 2009-09-11, released 2011-04-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.192
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endothelial protein C receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3jtca_
  • Chain 'B':
    Compound: Endothelial protein C receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3jtcb_
  • Chain 'C':
    Compound: Vitamin K-dependent protein C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3jtcc_
  • Chain 'D':
    Compound: Vitamin K-dependent protein C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3jtcd_
  • Heterogens: NAG, NDG, PTY, MG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jtcA (A:)
    sqdasdglqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepe
    swartqsglqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavng
    ssfvsfrperalwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhisae
    ntkgsqtsrsyts
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jtcA (A:)
    glqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartq
    sglqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsf
    rperalwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3jtcB (B:)
    sqdasdglqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepe
    swartqsglqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavng
    ssfvsfrperalwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhisae
    ntkgsqtsrsyts
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jtcB (B:)
    lqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartqs
    glqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsfr
    peralwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhisae
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jtcC (C:)
    ansfleelrhsslerecieeicdfeeakeifqn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jtcD (D:)
    ansfleelrhsslerecieeicdfeeakeifqn