PDB entry 3jso

View 3jso on RCSB PDB site
Description: Classic Protein With a New Twist: crystal structure of a LexA repressor DNA complex
Class: Hydrolase/DNA
Keywords: protein-DNA complex, winged helix-turn-helix, double helix, repressor, LexA, SOS system, Autocatalytic cleavage, DNA damage, DNA repair, DNA replication, DNA-binding, Hydrolase, SOS response, Transcription, Transcription regulation, Hydrolase-DNA COMPLEX
Deposited on 2009-09-10, released 2010-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lexa repressor
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: lexA, exrA, spr, tsl, umuA, b4043, JW4003
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7C2
      • engineered (155)
    Domains in SCOPe 2.07: d3jsoa1, d3jsoa2
  • Chain 'B':
    Compound: lexa repressor
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: lexA, exrA, spr, tsl, umuA, b4043, JW4003
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7C2 (Start-201)
      • engineered (155)
    Domains in SCOPe 2.07: d3jsob1, d3jsob2
  • Chain 'C':
    Compound: DNA (5'-d(*tp*ap*tp*ap*cp*tp*gp*tp*ap*tp*ap*tp*ap*tp*ap*tp*ap*cp*ap*gp*tp*a)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*ap*tp*ap*cp*tp*gp*tp*ap*tp*ap*tp*ap*tp*ap*tp*ap*cp*ap*gp*tp*a)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jsoA (A:)
    mkaltarqqevfdlirdhisqtgmpptraeiaqrlgfrspnaaeehlkalarkgvieivs
    gasrgirllqeeeeglplvgrvaagepllaqqhieghyqvdpslfkpnadfllrvsgmsm
    kdigimdgdllavhktqdvrngqvvvariddevtvarlkkqgnkvellpensefkpivvd
    lrqqsftieglavgvirngdwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jsoA (A:)
    kaltarqqevfdlirdhisqtgmpptraeiaqrlgfrspnaaeehlkalarkgvieivsg
    asrgirllglplvgrvaageplieghyqvdpslfkpnadfllrvsgmsmkdigimdgdll
    avhktqdvrngqvvvariddevtvarlkkqgnkvellpensefkpivvdlrqqsftiegl
    avgvirng
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3jsoB (B:)
    mkaltarqqevfdlirdhisqtgmpptraeiaqrlgfrspnaaeehlkalarkgvieivs
    gasrgirllqeeeeglplvgrvaagepllaqqhieghyqvdpslfkpnadfllrvsgmsm
    kdigimdgdllavhktqdvrngqvvvariddevtvarlkkqgnkvellpensefkpivvd
    lrqqsftieglavgvirngdwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jsoB (B:)
    kaltarqqevfdlirdhisqtgmpptraeiaqrlgfrspnaaeehlkalarkgvieivsg
    asrgirllglplvgrvaageieghyqvdpslfkpnadfllrvsgmsmkdigimdgdllav
    hktqdvrngqvvvariddevtvarlkkqgnkvellpensefkpivvdlrqqsftieglav
    gvirngdwl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.