PDB entry 3jse

View 3jse on RCSB PDB site
Description: Crystal structure of archaeal 20S proteasome in complex with mutated P26 activator
Class: hydrolase/hydrolase activator
Keywords: 20S proteasome, PA26, proteasome activation, Cytoplasm, Hydrolase, Protease, Proteasome, Threonine protease, HYDROLASE/HYDROLASE ACTIVATOR COMPLEX
Deposited on 2009-09-10, released 2009-11-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-01-26, with a file datestamp of 2010-01-22.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.213
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jsea_
  • Chain 'B':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jseb_
  • Chain 'C':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jsec_
  • Chain 'D':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jsed_
  • Chain 'E':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jsee_
  • Chain 'F':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jsef_
  • Chain 'G':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jseg_
  • Chain 'H':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jseh_
  • Chain 'I':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jsei_
  • Chain 'J':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jsej_
  • Chain 'K':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jsek_
  • Chain 'L':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jsel_
  • Chain 'M':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jsem_
  • Chain 'N':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jsen_
  • Chain 'O':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-227)
      • variant (45)
      • engineered (226)
      • engineered (222)
    Domains in SCOPe 2.01: d3jseo_
  • Chain 'P':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-227)
      • variant (45)
      • engineered (226)
      • engineered (222)
    Domains in SCOPe 2.01: d3jsep_
  • Chain 'Q':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-227)
      • variant (45)
      • engineered (226)
      • engineered (222)
    Domains in SCOPe 2.01: d3jseq_
  • Chain 'R':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-227)
      • variant (45)
      • engineered (226)
      • engineered (222)
    Domains in SCOPe 2.01: d3jser_
  • Chain 'S':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-227)
      • variant (45)
      • engineered (226)
      • engineered (222)
    Domains in SCOPe 2.01: d3jses_
  • Chain 'T':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-227)
      • variant (45)
      • engineered (226)
      • engineered (222)
    Domains in SCOPe 2.01: d3jset_
  • Chain 'U':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-227)
      • variant (45)
      • engineered (226)
      • engineered (222)
    Domains in SCOPe 2.01: d3jseu_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jseA (A:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jseB (B:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jseC (C:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jseD (D:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jseE (E:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jseF (F:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jseG (G:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jseH (H:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jseI (I:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jseJ (J:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jseK (K:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jseL (L:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jseM (M:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jseN (N:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3jseO (O:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jseO (O:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgtdhmfs
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3jseP (P:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jseP (P:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgtdhmfs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3jseQ (Q:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jseQ (Q:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgtdhmfs
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3jseR (R:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jseR (R:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgtdhmfs
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3jseS (S:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jseS (S:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgtdhmfs
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3jseT (T:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jseT (T:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgtdhmfs
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3jseU (U:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jseU (U:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgtdhmfs