PDB entry 3js4

View 3js4 on RCSB PDB site
Description: Crystal structure of iron superoxide dismutase from Anaplasma phagocytophilum
Class: oxidoreductase
Keywords: NIAID, SSGCID, Seattle Structural Genomics Center for Infectious Disease, gram-negative bacteria, human granulocytic anaplasmosis, Fe, metalloenzyme, Oxidoreductase
Deposited on 2009-09-09, released 2009-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Anaplasma phagocytophilum [TaxId:212042]
    Gene: sodB, APH_0371
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2GKX4 (21-226)
      • expression tag (20)
    Domains in SCOPe 2.07: d3js4a1, d3js4a2, d3js4a3
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Anaplasma phagocytophilum [TaxId:212042]
    Gene: sodB, APH_0371
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2GKX4 (21-226)
      • expression tag (20)
    Domains in SCOPe 2.07: d3js4b1, d3js4b2, d3js4b3
  • Chain 'C':
    Compound: superoxide dismutase
    Species: Anaplasma phagocytophilum [TaxId:212042]
    Gene: sodB, APH_0371
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3js4c1, d3js4c2
  • Chain 'D':
    Compound: superoxide dismutase
    Species: Anaplasma phagocytophilum [TaxId:212042]
    Gene: sodB, APH_0371
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3js4d1, d3js4d2
  • Heterogens: FE, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3js4A (A:)
    mahhhhhhmgtleaqtqgpgsmfelsdlpyeglepyisshlldrhynghhktyvdvlnkl
    vvgtefeglgneslgdivvkahnsgsagraifnnaaqiwnhdfywqsmkpngggnppekl
    remiehsfgsvegfnnafttsglgqfgsgwvwlvydedakalkvvstanadsplltqgql
    platmdvwehayyldylnlrkkyidvflehllnwdfvlgrledagvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3js4A (A:)
    smfelsdlpyeglepyisshlldrhynghhktyvdvlnklvvgtefeglgneslgdivvk
    ahnsgsagraifnnaaqiwnhdfywqsmkpngggnppeklremiehsfgsvegfnnaftt
    sglgqfgsgwvwlvydedakalkvvstanadsplltqgqlplatmdvwehayyldylnlr
    kkyidvflehllnwdfvlgrledagvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3js4B (B:)
    mahhhhhhmgtleaqtqgpgsmfelsdlpyeglepyisshlldrhynghhktyvdvlnkl
    vvgtefeglgneslgdivvkahnsgsagraifnnaaqiwnhdfywqsmkpngggnppekl
    remiehsfgsvegfnnafttsglgqfgsgwvwlvydedakalkvvstanadsplltqgql
    platmdvwehayyldylnlrkkyidvflehllnwdfvlgrledagvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3js4B (B:)
    smfelsdlpyeglepyisshlldrhynghhktyvdvlnklvvgtefeglgneslgdivvk
    ahnsgsagraifnnaaqiwnhdfywqsmkpngggnppeklremiehsfgsvegfnnaftt
    sglgqfgsgwvwlvydedakalkvvstanadsplltqgqlplatmdvwehayyldylnlr
    kkyidvflehllnwdfvlgrledagvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3js4C (C:)
    mahhhhhhmgtleaqtqgpgsmfelsdlpyeglepyisshlldrhynghhktyvdvlnkl
    vvgtefeglgneslgdivvkahnsgsagraifnnaaqiwnhdfywqsmkpngggnppekl
    remiehsfgsvegfnnafttsglgqfgsgwvwlvydedakalkvvstanadsplltqgql
    platmdvwehayyldylnlrkkyidvflehllnwdfvlgrledagvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3js4C (C:)
    mfelsdlpyeglepyisshlldrhynghhktyvdvlnklvvgtefeglgneslgdivvka
    hnsgsagraifnnaaqiwnhdfywqsmkpngggnppeklremiehsfgsvegfnnaftts
    glgqfgsgwvwlvydedakalkvvstanadsplltqgqlplatmdvwehayyldylnlrk
    kyidvflehllnwdfvlgrledagvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3js4D (D:)
    mahhhhhhmgtleaqtqgpgsmfelsdlpyeglepyisshlldrhynghhktyvdvlnkl
    vvgtefeglgneslgdivvkahnsgsagraifnnaaqiwnhdfywqsmkpngggnppekl
    remiehsfgsvegfnnafttsglgqfgsgwvwlvydedakalkvvstanadsplltqgql
    platmdvwehayyldylnlrkkyidvflehllnwdfvlgrledagvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3js4D (D:)
    mfelsdlpyeglepyisshlldrhynghhktyvdvlnklvvgtefeglgneslgdivvka
    hnsgsagraifnnaaqiwnhdfywqsmkpngggnppeklremiehsfgsvegfnnaftts
    glgqfgsgwvwlvydedakalkvvstanadsplltqgqlplatmdvwehayyldylnlrk
    kyidvflehllnwdfvlgrledagvl