PDB entry 3jrm

View 3jrm on RCSB PDB site
Description: Crystal structure of archaeal 20S proteasome in complex with mutated P26 activator
Class: hydrolase/hydrolase activator
Keywords: 20S proteasome, PA26, Cytoplasm, Hydrolase, Protease, Proteasome, Threonine protease, HYDROLASE/HYDROLASE ACTIVATOR COMPLEX
Deposited on 2009-09-08, released 2009-11-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-01-26, with a file datestamp of 2010-01-22.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.202
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jrma_
  • Chain 'B':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jrmb_
  • Chain 'C':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jrmc_
  • Chain 'D':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jrmd_
  • Chain 'E':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jrme_
  • Chain 'F':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jrmf_
  • Chain 'G':
    Compound: Proteasome subunit alpha
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmA, Ta1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jrmg_
  • Chain 'H':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jrmh_
  • Chain 'I':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jrmi_
  • Chain 'J':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jrmj_
  • Chain 'K':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jrmk_
  • Chain 'L':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jrml_
  • Chain 'M':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jrmm_
  • Chain 'N':
    Compound: Proteasome subunit beta
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: psmB, Ta0612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jrmn_
  • Chain 'O':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-227)
      • variant (45)
      • engineered (98)
      • engineered (226)
      • engineered (222)
    Domains in SCOPe 2.01: d3jrmo_
  • Chain 'P':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-227)
      • variant (45)
      • engineered (98)
      • engineered (226)
      • engineered (222)
    Domains in SCOPe 2.01: d3jrmp_
  • Chain 'Q':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-227)
      • variant (45)
      • engineered (98)
      • engineered (226)
      • engineered (222)
    Domains in SCOPe 2.01: d3jrmq_
  • Chain 'R':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-227)
      • variant (45)
      • engineered (98)
      • engineered (226)
      • engineered (222)
    Domains in SCOPe 2.01: d3jrmr_
  • Chain 'S':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-227)
      • variant (45)
      • engineered (98)
      • engineered (226)
      • engineered (222)
    Domains in SCOPe 2.01: d3jrms_
  • Chain 'T':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-227)
      • variant (45)
      • engineered (98)
      • engineered (226)
      • engineered (222)
    Domains in SCOPe 2.01: d3jrmt_
  • Chain 'U':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-227)
      • variant (45)
      • engineered (98)
      • engineered (226)
      • engineered (222)
    Domains in SCOPe 2.01: d3jrmu_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jrmA (A:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jrmB (B:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jrmC (C:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jrmD (D:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jrmE (E:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jrmF (F:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jrmG (G:)
    aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
    iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
    ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
    keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jrmH (H:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jrmI (I:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jrmJ (J:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jrmK (K:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jrmL (L:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jrmM (M:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jrmN (N:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3jrmO (O:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jrmO (O:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgtdhmys
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3jrmP (P:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jrmP (P:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgtdhmys
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3jrmQ (Q:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jrmQ (Q:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgtdhmys
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3jrmR (R:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jrmR (R:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgtdhmys
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3jrmS (S:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jrmS (S:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgtdhmys
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3jrmT (T:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jrmT (T:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgtdhmys
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3jrmU (U:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jrmU (U:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
    velatthlstmvravinayllnwkkliqprtgtdhmys