PDB entry 3jr8

View 3jr8 on RCSB PDB site
Description: Crystal Structure of BthTX-II (Asp49-PLA2 from Bothrops jararacussu snake venom) with calcium ions
Class: hydrolase
Keywords: Phospholipases A2, Asp49-PLA2, miotoxic Asp49-PLA2, bothropstoxin II, BthTX-II, Disulfide bond, Hydrolase, Lipid degradation, Metal-binding, Secreted
Deposited on 2009-09-08, released 2010-09-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-09-08, with a file datestamp of 2010-09-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.219
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 bothropstoxin-2
    Species: Bothrops jararacussu [TaxId:8726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jr8a_
  • Chain 'B':
    Compound: Phospholipase A2 bothropstoxin-2
    Species: Bothrops jararacussu [TaxId:8726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jr8b_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3jr8A (A:)
dlwqfgqmilketgklpfpyyttygcycgwggqgqpkdatdrccfvhdccygkltnckpk
tdrysysrengviicgegtpcekqicecdkaaavcfrenlrtykkrymaypdvlckkpae
kc

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3jr8B (B:)
dlwqfgqmilketgklpfpyyttygcycgwggqgqpkdatdrccfvhdccygkltnckpk
tdrysysrengviicgegtpcekqicecdkaaavcfrenlrtykkrymaypdvlckkpae
kc