PDB entry 3ixt

View 3ixt on RCSB PDB site
Description: Crystal Structure of Motavizumab Fab Bound to Peptide Epitope
Class: immune system
Keywords: Fab, RSV, Synagis, Motavizumab, monoclonal, complex, Cell membrane, Cleavage on pair of basic residues, Disulfide bond, Envelope protein, Fusion protein, Glycoprotein, Lipoprotein, Membrane, Palmitate, Transmembrane, Virion, IMMUNE SYSTEM
Deposited on 2009-09-04, released 2010-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.216
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Motavizumab Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IXT (0-End)
  • Chain 'B':
    Compound: Motavizumab Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IXT (0-End)
    Domains in SCOPe 2.07: d3ixtb1, d3ixtb2
  • Chain 'C':
    Compound: Fusion glycoprotein F1
    Species: Human respiratory syncytial virus [TaxId:11259]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Motavizumab Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IXT (0-End)
  • Chain 'L':
    Compound: Motavizumab Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IXT (0-End)
    Domains in SCOPe 2.07: d3ixtl1, d3ixtl2
  • Chain 'P':
    Compound: Fusion glycoprotein F1
    Species: Human respiratory syncytial virus [TaxId:11259]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ixtB (B:)
    diqmtqspstlsasvgdrvtitcsassrvgymhwyqqkpgkapklliydtsklasgvpsr
    fsgsgsgteftltisslqpddfatyycfqgsgypftfgggtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ixtB (B:)
    diqmtqspstlsasvgdrvtitcsassrvgymhwyqqkpgkapklliydtsklasgvpsr
    fsgsgsgteftltisslqpddfatyycfqgsgypftfgggtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'C':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3ixtL (L:)
    diqmtqspstlsasvgdrvtitcsassrvgymhwyqqkpgkapklliydtsklasgvpsr
    fsgsgsgteftltisslqpddfatyycfqgsgypftfgggtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ixtL (L:)
    diqmtqspstlsasvgdrvtitcsassrvgymhwyqqkpgkapklliydtsklasgvpsr
    fsgsgsgteftltisslqpddfatyycfqgsgypftfgggtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'P':
    No sequence available.