PDB entry 3ixp

View 3ixp on RCSB PDB site
Description: Crystal structure of the ecdysone receptor bound to BYI08346
Class: transcription
Keywords: anti-parallel alpha-helices, Transcription, Transcription regulation
Deposited on 2009-09-04, released 2010-12-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.221
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gene regulation protein
    Species: Heliothis virescens [TaxId:7102]
    Gene: ECR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3ixpa_
  • Chain 'D':
    Compound: Ecdysone receptor
    Species: Helicoverpa armigera [TaxId:29058]
    Gene: USP
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9UCQ4
      • engineered (35)
      • engineered (93)
      • engineered (188)
      • engineered (215)
    Domains in SCOPe 2.01: d3ixpd_
  • Heterogens: EPH, 834, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ixpA (A:)
    mvqelsierllemeslvadpseefqflrvgpdsnvppkfrapvsslcqignkqiaalvvw
    ardiphfsqlemedqillikgswnelllfaiawrsmeflteerdgvdgtgnrttsppqlm
    clmpgmtlhrnsalqagvgqifdrvlselslkmrtlrvdqaeyvalkaiillnpdvkglk
    nrqevevlrekmflcldeycrrsrsseegrfaalllrlpalrsislksfehlfffhlvad
    tsiagyirdalrnhappidtnmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ixpA (A:)
    qelsierllemeslvadpseefqflrvgpdsnvppkfrapvsslcqignkqiaalvvwar
    diphfsqlemedqillikgswnelllfaiawrsmefltsppqlmclmpgmtlhrnsalqa
    gvgqifdrvlselslkmrtlrvdqaeyvalkaiillnpdvkglknrqevevlrekmflcl
    deycrrsrsseegrfaalllrlpalrsislksfehlfffhlvadtsiagyirdalrnhap
    pi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ixpD (D:)
    gshmasmtggqqmgrdpknvppltanqksliarlvyyqegyeqpseedlkrvtqtwqsde
    ddedsdmpfrqitemtiltvqlivefakglpgfskisqsdqitllkacssevmmlrvarr
    ydaatdsvlfannqaytrdnyrkagmayviedllhfcrcmysmmmdnvhyalltaivifs
    drpgleqpslveeiqryylntlrvyilnqnsasprsavifgkilgilteirtlgmqnsnm
    cislklknrklppfleeiwdvadva
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ixpD (D:)
    vppltanqksliarlvyyqegyeqmpfrqitemtiltvqlivefakglpgfskisqsdqi
    tllkacssevmmlrvarrydaatdsvlfannqaytrdnyrkagmayviedllhfcrcmys
    mmmdnvhyalltaivifsdrpgleqpslveeiqryylntlrvyilnqnsasprsavifgk
    ilgilteirtlgmqnsnmcislklknrklppfleeiwdva