PDB entry 3ixg

View 3ixg on RCSB PDB site
Description: X-ray crystal structure of the extended-spectrum AmpC T70I mutant beta-lactamase with and without benzo(b)thiophene-2-boronic acid bound at 2.14 Angstrom resolution
Class: hydrolase
Keywords: serine hydrolase, beta-lactamase, cephalosporinase, extended-spectrum antibiotic resistance, Antibiotic resistance, Hydrolase, Periplasm
Deposited on 2009-09-04, released 2010-02-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-02-16, with a file datestamp of 2010-02-12.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.199
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:83333]
    Gene: ampA, ampC, b4150, JW4111
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00811 (0-357)
      • engineered (66)
    Domains in SCOPe 2.05: d3ixga_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:83333]
    Gene: ampA, ampC, b4150, JW4111
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00811 (0-357)
      • engineered (66)
    Domains in SCOPe 2.05: d3ixgb_
  • Heterogens: BZB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ixgA (A:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktfigvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ixgA (A:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktfigvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    ellrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplklnhtwi
    nvpgvkstiedmarwvqsnlkpldinektlqqgiqlaqsrywqtgdmyqglgwemldwpv
    npdsiiialaarpvkaitpptpavraswvhktgatggfgsyvafipekelgivmlankny
    pnparvdaawqilnalq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ixgB (B:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktfigvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq