PDB entry 3iwr

View 3iwr on RCSB PDB site
Description: Crystal structure of class I chitinase from Oryza sativa L. japonica
Class: hydrolase
Keywords: class I chitinase, Oryza sativa L. japonica, Chitin-binding, Glycosidase, Hydrolase
Deposited on 2009-09-03, released 2010-04-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-06-30, with a file datestamp of 2010-06-25.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.182
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: Cht-2, OsJ_18467
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3iwra_
  • Chain 'B':
    Compound: chitinase
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: Cht-2, OsJ_18467
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3iwrb_
  • Heterogens: MES, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iwrA (A:)
    meqcgaqaggarcpnclccsrwgwcgttsdfcgdgcqsqcsgcgptptptppspsdgvgs
    ivprdlferlllhrndgacpargfytyeaflaaaaafpafggtgntetrkrevaaflgqt
    shettggwptapdgpfswgycfkqeqnppsdycqpspewpcapgrkyygrgpiqlsfnfn
    ygpagraigvdllsnpdlvatdatvsfktalwfwmtpqgnkpsshdvitgrwapspadaa
    agrapgygvitnivngglecghgpddrvanrigfyqrycgafgigtggnldcynqrpfns
    gssvglaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwrA (A:)
    dgvgsivprdlferlllhrndgacpargfytyeaflaaaaafpafggtgntetrkrevaa
    flgqtshettggwptapdgpfswgycfkqeqnppsdycqpspewpcapgrkyygrgpiql
    sfnfnygpagraigvdllsnpdlvatdatvsfktalwfwmtpqgnkpsshdvitgrwaps
    padaaagrapgygvitnivngglecghgpddrvanrigfyqrycgafgigtggnldcynq
    rpfn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3iwrB (B:)
    meqcgaqaggarcpnclccsrwgwcgttsdfcgdgcqsqcsgcgptptptppspsdgvgs
    ivprdlferlllhrndgacpargfytyeaflaaaaafpafggtgntetrkrevaaflgqt
    shettggwptapdgpfswgycfkqeqnppsdycqpspewpcapgrkyygrgpiqlsfnfn
    ygpagraigvdllsnpdlvatdatvsfktalwfwmtpqgnkpsshdvitgrwapspadaa
    agrapgygvitnivngglecghgpddrvanrigfyqrycgafgigtggnldcynqrpfns
    gssvglaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwrB (B:)
    psdgvgsivprdlferlllhrndgacpargfytyeaflaaaaafpafggtgntetrkrev
    aaflgqtshettggwptapdgpfswgycfkqeqnppsdycqpspewpcapgrkyygrgpi
    qlsfnfnygpagraigvdllsnpdlvatdatvsfktalwfwmtpqgnkpsshdvitgrwa
    pspadaaagrapgygvitnivngglecghgpddrvanrigfyqrycgafgigtggnldcy
    nqrpfn