PDB entry 3iwk

View 3iwk on RCSB PDB site
Description: Crystal structure of aminoaldehyde dehydrogenase 1 from Pisum sativum (PsAMADH1)
Class: oxidoreductase
Keywords: Rossmann fold, dimer, aminoaldehyde dehydrogenase, betaine aldehyde dehydrogenase, NAD, Oxidoreductase
Deposited on 2009-09-02, released 2010-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.202
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminoaldehyde dehydrogenase
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: amadh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iwka_
  • Chain 'B':
    Compound: Aminoaldehyde dehydrogenase
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: amadh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iwkb_
  • Chain 'C':
    Compound: Aminoaldehyde dehydrogenase
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: amadh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iwkc_
  • Chain 'D':
    Compound: Aminoaldehyde dehydrogenase
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: amadh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iwkd_
  • Chain 'E':
    Compound: Aminoaldehyde dehydrogenase
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: amadh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iwke_
  • Chain 'F':
    Compound: Aminoaldehyde dehydrogenase
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: amadh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iwkf_
  • Chain 'G':
    Compound: Aminoaldehyde dehydrogenase
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: amadh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iwkg_
  • Chain 'H':
    Compound: Aminoaldehyde dehydrogenase
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: amadh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iwkh_
  • Chain 'I':
    Compound: Aminoaldehyde dehydrogenase
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: amadh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iwki_
  • Chain 'J':
    Compound: Aminoaldehyde dehydrogenase
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: amadh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iwkj_
  • Chain 'K':
    Compound: Aminoaldehyde dehydrogenase
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: amadh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iwkk_
  • Chain 'L':
    Compound: Aminoaldehyde dehydrogenase
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: amadh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iwkl_
  • Heterogens: NA, NAD, GOL, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iwkA (A:)
    maitvssrqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisr
    kngrdwsaasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfey
    yaglaeeldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagc
    aailkpselasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgss
    atgskimttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrl
    ivhesiavefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatil
    tggrrpehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyg
    lgsavmsndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenyl
    svkqvtrytsdepwgwyqppskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwkA (A:)
    srqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisrkngrdw
    saasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfeyyaglae
    eldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagcaailkp
    selasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgssatgski
    mttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrlivhesi
    avefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatiltggrrp
    ehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyglgsavm
    sndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenylsvkqvt
    rytsdepwgwyqppsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3iwkB (B:)
    maitvssrqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisr
    kngrdwsaasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfey
    yaglaeeldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagc
    aailkpselasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgss
    atgskimttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrl
    ivhesiavefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatil
    tggrrpehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyg
    lgsavmsndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenyl
    svkqvtrytsdepwgwyqppskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwkB (B:)
    srqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisrkngrdw
    saasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfeyyaglae
    eldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagcaailkp
    selasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgssatgski
    mttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrlivhesi
    avefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatiltggrrp
    ehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyglgsavm
    sndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenylsvkqvt
    rytsdepwgwyqppsk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3iwkC (C:)
    maitvssrqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisr
    kngrdwsaasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfey
    yaglaeeldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagc
    aailkpselasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgss
    atgskimttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrl
    ivhesiavefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatil
    tggrrpehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyg
    lgsavmsndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenyl
    svkqvtrytsdepwgwyqppskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwkC (C:)
    srqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisrkngrdw
    saasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfeyyaglae
    eldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagcaailkp
    selasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgssatgski
    mttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrlivhesi
    avefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatiltggrrp
    ehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyglgsavm
    sndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenylsvkqvt
    rytsdepwgwyqpps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3iwkD (D:)
    maitvssrqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisr
    kngrdwsaasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfey
    yaglaeeldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagc
    aailkpselasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgss
    atgskimttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrl
    ivhesiavefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatil
    tggrrpehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyg
    lgsavmsndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenyl
    svkqvtrytsdepwgwyqppskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwkD (D:)
    srqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisrkngrdw
    saasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfeyyaglae
    eldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagcaailkp
    selasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgssatgski
    mttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrlivhesi
    avefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatiltggrrp
    ehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyglgsavm
    sndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenylsvkqvt
    rytsdepwgwyqppsk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3iwkE (E:)
    maitvssrqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisr
    kngrdwsaasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfey
    yaglaeeldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagc
    aailkpselasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgss
    atgskimttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrl
    ivhesiavefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatil
    tggrrpehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyg
    lgsavmsndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenyl
    svkqvtrytsdepwgwyqppskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwkE (E:)
    srqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisrkngrdw
    saasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfeyyaglae
    eldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagcaailkp
    selasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgssatgski
    mttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrlivhesi
    avefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatiltggrrp
    ehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyglgsavm
    sndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenylsvkqvt
    rytsdepwgwyqppsk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3iwkF (F:)
    maitvssrqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisr
    kngrdwsaasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfey
    yaglaeeldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagc
    aailkpselasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgss
    atgskimttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrl
    ivhesiavefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatil
    tggrrpehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyg
    lgsavmsndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenyl
    svkqvtrytsdepwgwyqppskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwkF (F:)
    srqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisrkngrdw
    saasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfeyyaglae
    eldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagcaailkp
    selasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgssatgski
    mttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrlivhesi
    avefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatiltggrrp
    ehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyglgsavm
    sndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenylsvkqvt
    rytsdepwgwyqpps
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3iwkG (G:)
    maitvssrqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisr
    kngrdwsaasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfey
    yaglaeeldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagc
    aailkpselasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgss
    atgskimttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrl
    ivhesiavefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatil
    tggrrpehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyg
    lgsavmsndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenyl
    svkqvtrytsdepwgwyqppskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwkG (G:)
    srqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisrkngrdw
    saasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfeyyaglae
    eldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagcaailkp
    selasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgssatgski
    mttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrlivhesi
    avefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatiltggrrp
    ehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyglgsavm
    sndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenylsvkqvt
    rytsdepwgwyqppsk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3iwkH (H:)
    maitvssrqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisr
    kngrdwsaasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfey
    yaglaeeldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagc
    aailkpselasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgss
    atgskimttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrl
    ivhesiavefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatil
    tggrrpehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyg
    lgsavmsndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenyl
    svkqvtrytsdepwgwyqppskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwkH (H:)
    ssrqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisrkngrd
    wsaasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfeyyagla
    eeldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagcaailk
    pselasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgssatgsk
    imttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrlivhes
    iavefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatiltggrr
    pehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyglgsav
    msndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenylsvkqv
    trytsdepwgwyqppsk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3iwkI (I:)
    maitvssrqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisr
    kngrdwsaasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfey
    yaglaeeldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagc
    aailkpselasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgss
    atgskimttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrl
    ivhesiavefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatil
    tggrrpehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyg
    lgsavmsndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenyl
    svkqvtrytsdepwgwyqppskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwkI (I:)
    srqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisrkngrdw
    saasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfeyyaglae
    eldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagcaailkp
    selasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgssatgski
    mttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrlivhesi
    avefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatiltggrrp
    ehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyglgsavm
    sndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenylsvkqvt
    rytsdepwgwyqppsk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3iwkJ (J:)
    maitvssrqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisr
    kngrdwsaasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfey
    yaglaeeldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagc
    aailkpselasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgss
    atgskimttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrl
    ivhesiavefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatil
    tggrrpehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyg
    lgsavmsndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenyl
    svkqvtrytsdepwgwyqppskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwkJ (J:)
    ssrqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisrkngrd
    wsaasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfeyyagla
    eeldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagcaailk
    pselasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgssatgsk
    imttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrlivhes
    iavefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatiltggrr
    pehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyglgsav
    msndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenylsvkqv
    trytsdepwgwyqppsk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3iwkK (K:)
    maitvssrqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisr
    kngrdwsaasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfey
    yaglaeeldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagc
    aailkpselasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgss
    atgskimttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrl
    ivhesiavefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatil
    tggrrpehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyg
    lgsavmsndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenyl
    svkqvtrytsdepwgwyqppskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwkK (K:)
    srqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisrkngrdw
    saasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfeyyaglae
    eldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagcaailkp
    selasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgssatgski
    mttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrlivhesi
    avefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatiltggrrp
    ehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyglgsavm
    sndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenylsvkqvt
    rytsdepwgwyqppsk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3iwkL (L:)
    maitvssrqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisr
    kngrdwsaasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfey
    yaglaeeldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagc
    aailkpselasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgss
    atgskimttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrl
    ivhesiavefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatil
    tggrrpehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyg
    lgsavmsndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenyl
    svkqvtrytsdepwgwyqppskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwkL (L:)
    ssrqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisrkngrd
    wsaasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfeyyagla
    eeldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagcaailk
    pselasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgssatgsk
    imttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrlivhes
    iavefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatiltggrr
    pehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyglgsav
    msndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenylsvkqv
    trytsdepwgwyqpps