PDB entry 3iwj

View 3iwj on RCSB PDB site
Description: Crystal structure of aminoaldehyde dehydrogenase 2 from Pisum sativum (PsAMADH2)
Class: oxidoreductase
Keywords: Rossmann fold, dimer, aminoaldehyde dehydrogenase, betaine aldehyde dehydrogenase, NAD, Oxidoreductase
Deposited on 2009-09-02, released 2010-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.236
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative aminoaldehyde dehydrogenase
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: amadh2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iwja_
  • Chain 'B':
    Compound: Putative aminoaldehyde dehydrogenase
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: amadh2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iwjb_
  • Heterogens: NAD, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iwjA (A:)
    mdipiptrqlfingdwkapvlnkripvinpatqniigdipaatkedvdvavaaaktaltr
    nkgadwatasgavrarylraiaakvtekkpelaklesidcgkpldeaawdiddvagcfey
    yadlaekldarqkapvslpmdtfkshvlrepigvvglitpwnypmlmatwkvapalaagc
    aailkpselasltclelgeickevglppgvlniltglgpeagaplathpdvdkvaftgss
    atgskimtaaaqlvkpvslelggksplvvfedvdldkaaewaifgcfwtngqicsatsrl
    ilhesiateflnrivkwiknikisdpleegcrlgpvvsegqyekilkfvsnaksegatil
    tggsrpehlkkgffieptiitdvttnmqiwreevfgpvlcvktfsteeeaidlandtvyg
    lgaavisndlercervtkafkagivwvncsqpcftqapwggvkrsgfgrelgewgldnyl
    svkqvtqyiseepwgwyqppakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwjA (A:)
    piptrqlfingdwkapvlnkripvinpatqniigdipaatkedvdvavaaaktaltrnkg
    adwatasgavrarylraiaakvtekkpelaklesidcgkpldeaawdiddvagcfeyyad
    laekldarqkapvslpmdtfkshvlrepigvvglitpwnypmlmatwkvapalaagcaai
    lkpselasltclelgeickevglppgvlniltglgpeagaplathpdvdkvaftgssatg
    skimtaaaqlvkpvslelggksplvvfedvdldkaaewaifgcfwtngqicsatsrlilh
    esiateflnrivkwiknikisdpleegcrlgpvvsegqyekilkfvsnaksegatiltgg
    srpehlkkgffieptiitdvttnmqiwreevfgpvlcvktfsteeeaidlandtvyglga
    avisndlercervtkafkagivwvncsqpcftqapwggvkrsgfgrelgewgldnylsvk
    qvtqyiseepwgwyqppakl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3iwjB (B:)
    mdipiptrqlfingdwkapvlnkripvinpatqniigdipaatkedvdvavaaaktaltr
    nkgadwatasgavrarylraiaakvtekkpelaklesidcgkpldeaawdiddvagcfey
    yadlaekldarqkapvslpmdtfkshvlrepigvvglitpwnypmlmatwkvapalaagc
    aailkpselasltclelgeickevglppgvlniltglgpeagaplathpdvdkvaftgss
    atgskimtaaaqlvkpvslelggksplvvfedvdldkaaewaifgcfwtngqicsatsrl
    ilhesiateflnrivkwiknikisdpleegcrlgpvvsegqyekilkfvsnaksegatil
    tggsrpehlkkgffieptiitdvttnmqiwreevfgpvlcvktfsteeeaidlandtvyg
    lgaavisndlercervtkafkagivwvncsqpcftqapwggvkrsgfgrelgewgldnyl
    svkqvtqyiseepwgwyqppakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iwjB (B:)
    piptrqlfingdwkapvlnkripvinpatqniigdipaatkedvdvavaaaktaltrnkg
    adwatasgavrarylraiaakvtekkpelaklesidcgkpldeaawdiddvagcfeyyad
    laekldarqkapvslpmdtfkshvlrepigvvglitpwnypmlmatwkvapalaagcaai
    lkpselasltclelgeickevglppgvlniltglgpeagaplathpdvdkvaftgssatg
    skimtaaaqlvkpvslelggksplvvfedvdldkaaewaifgcfwtngqicsatsrlilh
    esiateflnrivkwiknikisdpleegcrlgpvvsegqyekilkfvsnaksegatiltgg
    srpehlkkgffieptiitdvttnmqiwreevfgpvlcvktfsteeeaidlandtvyglga
    avisndlercervtkafkagivwvncsqpcftqapwggvkrsgfgrelgewgldnylsvk
    qvtqyiseepwgwyqppakl