PDB entry 3ivm

View 3ivm on RCSB PDB site
Description: apPEP_WT+PP closed state
Class: Hydrolase/Hydrolase Inhibitor
Keywords: prolyl endopeptidase, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2009-09-01, released 2010-05-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.222
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prolyl endopeptidase
    Species: Aeromonas punctata [TaxId:648]
    Gene: prolyl endopeptidase
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X6R4
      • see remark 999 (108)
      • see remark 999 (327-328)
      • see remark 999 (336-337)
      • see remark 999 (350)
      • see remark 999 (579)
    Domains in SCOPe 2.05: d3ivma1, d3ivma2
  • Heterogens: ZPR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ivmA (A:)
    gshmsgkarlhypvtrqgeqvdhyfgqavadpyrwleddrspeteawvkaqnavtqdyla
    qipyraaikeklaaswnyakegapfregryhyffkndglqnqnvlwrqqegkpaevfldp
    ntlspdgttaldqlsfsrdgrilayslslagsdwreihlmdveskqpletplkdvkfsgi
    swlgnegffyssydkpdgselsartdqhkvyfhrlgtaqeddrlvfgaipaqhhryvgat
    vteddrfllisaanstsgnrlyvkdlsqenaplltvqgdldadvslvdnkgstlylltnr
    dapnrrlvtvdaanpgpahwrdliperqqvltvhsgsgylfaeymvdatarveqfdyegk
    rvrevalpglgsvsgfngkhddpalyfgfenyaqpptlyrfepksgaislyrasaapfkp
    edyvseqrfyqskdgtrvpliisyrkglkldgsnptilygyggfdvsltpsfsvsvanwl
    dlggvyavanlrgggeygqawhlagtqqnkqnvfddfiaaaeylkaegytrtdrlairgg
    snggllvgavmtqrpdlmrvalpavgvldmlryhtftagtgwaydygtsadseamfdylk
    gysplhnvrpgvsypstmvttadhddrvvpahsfkfaatlqadnagphpqlirietnagh
    gagtpvaklieqsadiyaftlyemgyrelprqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ivmA (A:)
    lhypvtrqgeqvdhyfgqavadpyrwleddrspeteawvkaqnavtqdylaqipyraaik
    eklaaswnyakegapfregryhyffkndglqnqnvlwrqqegkpaevfldpntlspdgtt
    aldqlsfsrdgrilayslslagsdwreihlmdveskqpletplkdvkfsgiswlgnegff
    yssydkpdgselsartdqhkvyfhrlgtaqeddrlvfgaipaqhhryvgatvteddrfll
    isaanstsgnrlyvkdlsqenaplltvqgdldadvslvdnkgstlylltnrdapnrrlvt
    vdaanpgpahwrdliperqqvltvhsgsgylfaeymvdatarveqfdyegkrvrevalpg
    lgsvsgfngkhddpalyfgfenyaqpptlyrfepksgaislyrasaapfkpedyvseqrf
    yqskdgtrvpliisyrkglkldgsnptilygyggfdvsltpsfsvsvanwldlggvyava
    nlrgggeygqawhlagtqqnkqnvfddfiaaaeylkaegytrtdrlairggsnggllvga
    vmtqrpdlmrvalpavgvldmlryhtftagtgwaydygtsadseamfdylkgysplhnvr
    pgvsypstmvttadhddrvvpahsfkfaatlqadnagphpqlirietnaghgagtpvakl
    ieqsadiyaftlyemgyrelpr