PDB entry 3ivk
View 3ivk on RCSB PDB site
Description: Crystal Structure of the Catalytic Core of an RNA Polymerase Ribozyme Complexed with an Antigen Binding Antibody Fragment
Class: immune system / RNA
Keywords: catalytic RNA, protein RNA complex, RNA polymerase ribozyme, RNA hairpin epitope, immune system - RNA complex
Deposited on
2009-09-01, released
2010-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-11-01, with a file datestamp of
2017-10-27.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Fab heavy chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Fab light chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3ivkb1, d3ivkb2 - Chain 'C':
Compound: class I ligase product
- Chain 'H':
Compound: Fab heavy chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'L':
Compound: Fab light chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3ivkl1, d3ivkl2 - Chain 'M':
Compound: class I ligase product
- Heterogens: CD, MG, CL, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3ivkB (B:)
sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
srfsgsrsgtdftltisslqpedfatyycqqsysfpstfgqgtkveikrtvaapsvfifp
psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
tlskadyekhkvyacevthqglsspvtksfnrg
- Chain 'C':
No sequence available.
- Chain 'H':
No sequence available.
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>3ivkL (L:)
sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
srfsgsrsgtdftltisslqpedfatyycqqsysfpstfgqgtkveikrtvaapsvfifp
psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
tlskadyekhkvyacevthqglsspvtksfnrg
- Chain 'M':
No sequence available.