PDB entry 3iv2

View 3iv2 on RCSB PDB site
Description: Crystal structure of mature apo-Cathepsin L C25A mutant
Class: hydrolase
Keywords: Protease, mutant, apo, Disulfide bond, Glycoprotein, Hydrolase, Lysosome, Thiol protease, Zymogen
Deposited on 2009-08-31, released 2010-03-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.204
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSL1, CTSL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07711 (Start-219)
      • engineered (24)
    Domains in SCOPe 2.06: d3iv2a_
  • Chain 'B':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSL1, CTSL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07711 (0-219)
      • engineered (24)
    Domains in SCOPe 2.06: d3iv2b_
  • Heterogens: NAG, GOL, SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iv2A (A:)
    aprsvdwrekgyvtpvknqgqcgsawafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iv2A (A:)
    prsvdwrekgyvtpvknqgqcgsawafsatgalegqmfrktgrlislseqnlvdcsgpqg
    negcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqeka
    lmkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnnk
    ywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3iv2B (B:)
    aprsvdwrekgyvtpvknqgqcgsawafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iv2B (B:)
    aprsvdwrekgyvtpvknqgqcgsawafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnnkywl
    vknswgeewgmggyvkmakdrrnhcgiasaasyptv