PDB entry 3iun

View 3iun on RCSB PDB site
Description: apPEP_D622N opened state
Class: hydrolase
Keywords: prolyl endopeptidase, HYDROLASE
Deposited on 2009-08-31, released 2010-05-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.206
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prolyl endopeptidase
    Species: Aeromonas punctata [TaxId:648]
    Gene: prolyl endopeptidase
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X6R4
      • see remark 999 (108)
      • see remark 999 (327-328)
      • see remark 999 (336-337)
      • see remark 999 (350)
      • see remark 999 (579)
      • engineered (624)
    Domains in SCOPe 2.05: d3iuna1, d3iuna2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iunA (A:)
    gshmsgkarlhypvtrqgeqvdhyfgqavadpyrwleddrspeteawvkaqnavtqdyla
    qipyraaikeklaaswnyakegapfregryhyffkndglqnqnvlwrqqegkpaevfldp
    ntlspdgttaldqlsfsrdgrilayslslagsdwreihlmdveskqpletplkdvkfsgi
    swlgnegffyssydkpdgselsartdqhkvyfhrlgtaqeddrlvfgaipaqhhryvgat
    vteddrfllisaanstsgnrlyvkdlsqenaplltvqgdldadvslvdnkgstlylltnr
    dapnrrlvtvdaanpgpahwrdliperqqvltvhsgsgylfaeymvdatarveqfdyegk
    rvrevalpglgsvsgfngkhddpalyfgfenyaqpptlyrfepksgaislyrasaapfkp
    edyvseqrfyqskdgtrvpliisyrkglkldgsnptilygyggfdvsltpsfsvsvanwl
    dlggvyavanlrgggeygqawhlagtqqnkqnvfddfiaaaeylkaegytrtdrlairgg
    snggllvgavmtqrpdlmrvalpavgvldmlryhtftagtgwaydygtsadseamfdylk
    gysplhnvrpgvsypstmvttadhndrvvpahsfkfaatlqadnagphpqlirietnagh
    gagtpvaklieqsadiyaftlyemgyrelprqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iunA (A:)
    lhypvtrqgeqvdhyfgqavadpyrwleddrspeteawvkaqnavtqdylaqipyraaik
    eklaaswnyakegapfregryhyffkndglqnqnvlwrqqegkpaevfldpntlspdgtt
    aldqlsfsrdgrilayslslagsdwreihlmdveskqpletplkdvkfsgiswlgnegff
    yssydkpdgsartdqhkvyfhrlgtaqeddrlvfgaipaqhhryvgatvteddrfllisa
    anstsgnrlyvkdlsqenaplltvqgdldadvslvdnkgstlylltnrdapnrrlvtvda
    anpgpahwrdliperqqvltvhsgsgylfaeymvdatarveqfdyegkrvrevalpglgs
    vsgfngkhddpalyfgfenyaqpptlyrfepksgaislyrasaapfkpedyvseqrfyqs
    kdgtrvpliisyrkglkldgsnptilygyggfdvsltpsfsvsvanwldlggvyavanlr
    gggeygqawhlagtqqnkqnvfddfiaaaeylkaegytrtdrlairggsnggllvgavmt
    qrpdlmrvalpavgvldmlryhtftagtgwaydygtsadseamfdylkgysplhnvrpgv
    sypstmvttadhndrvvpahsfkfaatlqadnagphpqlirietnpvaklieqsadiyaf
    tlyemgyrelpr