PDB entry 3iu5
View 3iu5 on RCSB PDB site
Description: Crystal structure of the first bromodomain of human poly-bromodomain containing protein 1 (PB1)
Class: transcription
Keywords: PB1, polybromo 1 isoform 1, BAF180, Polybromo0ID, PBRM1, BRG1-associated factor 180, Structural Genomics, SGC, Structural Genomics Consortium, Bromodomain, Chromatin regulator, DNA-binding, Nucleus, Phosphoprotein, Transcription, Transcription regulation
Deposited on
2009-08-30, released
2009-09-22
The last revision prior to the SCOPe 2.08 freeze date was dated
2012-04-11, with a file datestamp of
2012-04-06.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.17
AEROSPACI score: 0.61
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protein polybromo-1
Species: Homo sapiens [TaxId:9606]
Gene: PB1, PBRM1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3iu5a1, d3iu5a2 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3iu5A (A:)
smtvdpiavchelyntirdykdeqgrllcelfirapkrrnqpdyyevvsqpidlmkiqqk
lkmeeyddvnlltadfqllfnnaksyykpdspeykaacklwdlylrtrnefvqkge
Sequence, based on observed residues (ATOM records): (download)
>3iu5A (A:)
smtvdpiavchelyntirdykdeqgrllcelfirapkrrnqpdyyevvsqpidlmkiqqk
lkmeeyddvnlltadfqllfnnaksyykpdspeykaacklwdlylrtrnefvqk