PDB entry 3isf

View 3isf on RCSB PDB site
Description: Structure of non-mineralized Bfrb (as-isolated) from Pseudomonas aeruginosa to 2.07A Resolution
Class: electron transport
Keywords: electron transport; iron storage, Heme, Iron, Iron storage, Metal-binding, ELECTRON TRANSPORT
Deposited on 2009-08-25, released 2010-02-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-02-23, with a file datestamp of 2010-02-19.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.2
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3isfa_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3isfb_
  • Chain 'C':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3isfc_
  • Chain 'D':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3isfd_
  • Chain 'E':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3isfe_
  • Chain 'F':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3isff_
  • Heterogens: K, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3isfA (A:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3isfA (A:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3isfB (B:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3isfB (B:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3isfC (C:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3isfC (C:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhed
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3isfD (D:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3isfD (D:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhed
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3isfE (E:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3isfE (E:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3isfF (F:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3isfF (F:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe