PDB entry 3is8

View 3is8 on RCSB PDB site
Description: Structure of mineralized Bfrb soaked with FeSO4 from Pseudomonas aeruginosa to 2.25A Resolution
Class: electron transport
Keywords: electron transport; iron storage, Heme, Iron, Iron storage, Metal-binding, ELECTRON TRANSPORT
Deposited on 2009-08-25, released 2010-02-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-02-23, with a file datestamp of 2010-02-19.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.179
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8a_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8b_
  • Chain 'C':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8c_
  • Chain 'D':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8d_
  • Chain 'E':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8e_
  • Chain 'F':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8f_
  • Chain 'G':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8g_
  • Chain 'H':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8h_
  • Chain 'I':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8i_
  • Chain 'J':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8j_
  • Chain 'K':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8k_
  • Chain 'L':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8l_
  • Chain 'M':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8m_
  • Chain 'N':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8n_
  • Chain 'O':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8o_
  • Chain 'P':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8p_
  • Chain 'Q':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8q_
  • Chain 'R':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8r_
  • Chain 'S':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8s_
  • Chain 'T':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8t_
  • Chain 'U':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8u_
  • Chain 'V':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8v_
  • Chain 'W':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8w_
  • Chain 'X':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3is8x_
  • Heterogens: FE2, K, HEM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3is8A (A:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8A (A:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3is8B (B:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8B (B:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3is8C (C:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8C (C:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3is8D (D:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8D (D:)
    gdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklieri
    lfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllkd
    ileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3is8E (E:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8E (E:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3is8F (F:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8F (F:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3is8G (G:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8G (G:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3is8H (H:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8H (H:)
    gdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklieri
    lfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllkd
    ileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3is8I (I:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8I (I:)
    gdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklieri
    lfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllkd
    ileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3is8J (J:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8J (J:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3is8K (K:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8K (K:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3is8L (L:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8L (L:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3is8M (M:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8M (M:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3is8N (N:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8N (N:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3is8O (O:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8O (O:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3is8P (P:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8P (P:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3is8Q (Q:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8Q (Q:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3is8R (R:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8R (R:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3is8S (S:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8S (S:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3is8T (T:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8T (T:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3is8U (U:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8U (U:)
    gdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklieri
    lfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllkd
    ileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3is8V (V:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8V (V:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3is8W (W:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8W (W:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3is8X (X:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is8X (X:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenylqshmhe