PDB entry 3is7

View 3is7 on RCSB PDB site
Description: Structure of mineralized Bfrb from Pseudomonas aeruginosa to 2.1A Resolution
Class: electron transport
Keywords: electron transport; iron storage, Heme, Iron, Iron storage, Metal-binding, ELECTRON TRANSPORT
Deposited on 2009-08-25, released 2010-02-02
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-02-23, with a file datestamp of 2010-02-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3is7s_
  • Chain 'T':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HEM, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3is7S (S:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3is7S (S:)
    gdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklieri
    lfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllkd
    ileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.