PDB entry 3irt

View 3irt on RCSB PDB site
Description: Crystal Structure of the I93M Mutant of Ubiquitin Carboxy-terminal Hydrolase L1
Class: hydrolase, ligase
Keywords: Ubiquitin Hydrolase, Parkinson's Disease Mutant, Cytoplasm, Disease mutation, Glycoprotein, Hydrolase, Ligase, Oxidation, Polymorphism, Protease, Thiol protease, Ubl conjugation pathway
Deposited on 2009-08-24, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-09, with a file datestamp of 2010-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.213
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase isozyme L1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGP9.5, UCHL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09936 (5-227)
      • engineered (97)
    Domains in SCOPe 2.07: d3irta_
  • Chain 'B':
    Compound: Ubiquitin carboxyl-terminal hydrolase isozyme L1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGP9.5, UCHL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09936 (5-227)
      • engineered (97)
    Domains in SCOPe 2.07: d3irtb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3irtA (A:)
    gplgsmqlkpmeinpemlnkvlsrlgvagqwrfvdvlgleeeslgsvpapacallllfpl
    taqhenfrkkqieelkgqevspkvyfmkqtignscgtmglihavannqdklgfedgsvlk
    qflsetekmspedrakcfekneaiqaahdavaqegqcrvddkvnfhfilfnnvdghlyel
    dgrmpfpvnhgassedtllkdaakvcreftereqgevrfsavalckaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3irtA (A:)
    mqlkpmeinpemlnkvlsrlgvagqwrfvdvlgleeeslgsvpapacallllfpltaqhe
    nfrkkqieelkgqevspkvyfmkqtignscgtmglihavannqdklgfedgsvlkqflse
    tekmspedrakcfekneaiqaahdavaqegqcrvddkvnfhfilfnnvdghlyeldgrmp
    fpvnhgassedtllkdaakvcreftereqgevrfsavalckaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3irtB (B:)
    gplgsmqlkpmeinpemlnkvlsrlgvagqwrfvdvlgleeeslgsvpapacallllfpl
    taqhenfrkkqieelkgqevspkvyfmkqtignscgtmglihavannqdklgfedgsvlk
    qflsetekmspedrakcfekneaiqaahdavaqegqcrvddkvnfhfilfnnvdghlyel
    dgrmpfpvnhgassedtllkdaakvcreftereqgevrfsavalckaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3irtB (B:)
    mqlkpmeinpemlnkvlsrlgvagqwrfvdvlgleeeslgsvpapacallllfpltaqhe
    nfrkkqieelkgqevspkvyfmkqtignscgtmglihavannqdklgfedgsvlkqflse
    tekmspedrakcfekneaiqaahdavaqegqcrvddkvnfhfilfnnvdghlyeldgrmp
    fpvnhgassedtllkdaakvcreftereqgevrfsavalckaa