PDB entry 3iqh

View 3iqh on RCSB PDB site
Description: Structure of O-Acetylserine Sulfhydrylase in Complex with Peptide MNYDI
Class: transferase
Keywords: PROTEIN-PEPTIDE COMPLEX, Allosteric enzyme, Amino-acid biosynthesis, Cysteine biosynthesis, Pyridoxal phosphate, Transferase
Deposited on 2009-08-20, released 2009-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-01-19, with a file datestamp of 2010-01-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.165
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: mnydi
    Database cross-references and differences (RAF-indexed):
    • PDB 3IQH (Start-4)
  • Chain 'X':
    Compound: Cysteine synthase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: cysK, HI1103
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iqhx_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'P':
    No sequence available.

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3iqhX (X:)
    maiyadnsysigntplvrlkhfghngnvvvkiegrnpsysvkcriganmvwqaekdgtlt
    kgkeivdatsgntgialayvaaargykitltmpetmslerkrllcglgvnlvltegakgm
    kgaiakaeeivasdpsryvmlkqfenpanpqihrettgpeiwkdtdgkvdvvvagvgtgg
    sitgisraikldfgkqitsvavepvespvisqtlageevkpgphkiqgigagfipknldl
    siidrvetvdsdtalatarrlmaeegilagissgaavaaadrlaklpefadklivvilps
    aserylstalfegieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iqhX (X:)
    aiyadnsysigntplvrlkhfghngnvvvkiegrnpsysvkcriganmvwqaekdgtltk
    gkeivdatsgntgialayvaaargykitltmpetmslerkrllcglgvnlvltegakgmk
    gaiakaeeivasdpsryvmlkqfenpanpqihrettgpeiwkdtdgkvdvvvagvgtggs
    itgisraikldfgkqitsvavepvespvisqtlageevkpgphkiqgigagfipknldls
    iidrvetvdsdtalatarrlmaeegilagissgaavaaadrlaklpefadklivvilpsa
    serylstalf