PDB entry 3iq1

View 3iq1 on RCSB PDB site
Description: Crystal structure of DPS protein from Vibrio cholerae O1, a member of a broad superfamily of ferritin-like diiron-carboxylate proteins
Class: metal transport
Keywords: CSGID, DPS family protein, SAD, NIAID, METAL TRANSPORT, Structural Genomics, Center for Structural Genomics of Infectious Diseases
Deposited on 2009-08-18, released 2009-09-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.141
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dps family protein
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_0139
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3iq1a_
  • Chain 'B':
    Compound: Dps family protein
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_0139
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KVK4 (3-158)
      • expression tag (0-2)
    Domains in SCOPe 2.04: d3iq1b_
  • Chain 'C':
    Compound: Dps family protein
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_0139
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KVK4 (3-158)
      • expression tag (2)
    Domains in SCOPe 2.04: d3iq1c_
  • Chain 'D':
    Compound: Dps family protein
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_0139
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KVK4 (3-158)
      • expression tag (0-2)
    Domains in SCOPe 2.04: d3iq1d_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iq1A (A:)
    snamatnligldttqsqklanalnnllanyqvfymntrgyhwniqgkeffelhakfeeiy
    tdlqlkidelaeriltlsarpmhsfsgylkaaqikehtdsidgrssmqglvdgfsillhq
    qrdilelagetgdegtsalmsdyireqeklvwmlnawlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iq1A (A:)
    matnligldttqsqklanalnnllanyqvfymntrgyhwniqgkeffelhakfeeiytdl
    qlkidelaeriltlsarpmhsfsgylkaaqikehtdsidgrssmqglvdgfsillhqqrd
    ilelagetgdegtsalmsdyireqeklvwmlnawlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3iq1B (B:)
    snamatnligldttqsqklanalnnllanyqvfymntrgyhwniqgkeffelhakfeeiy
    tdlqlkidelaeriltlsarpmhsfsgylkaaqikehtdsidgrssmqglvdgfsillhq
    qrdilelagetgdegtsalmsdyireqeklvwmlnawlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3iq1C (C:)
    snamatnligldttqsqklanalnnllanyqvfymntrgyhwniqgkeffelhakfeeiy
    tdlqlkidelaeriltlsarpmhsfsgylkaaqikehtdsidgrssmqglvdgfsillhq
    qrdilelagetgdegtsalmsdyireqeklvwmlnawlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iq1C (C:)
    amatnligldttqsqklanalnnllanyqvfymntrgyhwniqgkeffelhakfeeiytd
    lqlkidelaeriltlsarpmhsfsgylkaaqikehtdsidgrssmqglvdgfsillhqqr
    dilelagetgdegtsalmsdyireqeklvwmlnawlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3iq1D (D:)
    snamatnligldttqsqklanalnnllanyqvfymntrgyhwniqgkeffelhakfeeiy
    tdlqlkidelaeriltlsarpmhsfsgylkaaqikehtdsidgrssmqglvdgfsillhq
    qrdilelagetgdegtsalmsdyireqeklvwmlnawlk