PDB entry 3ipi

View 3ipi on RCSB PDB site
Description: Crystal Structure of a Geranyltranstransferase from the Methanosarcina mazei
Class: transferase
Keywords: Geranyltranstransferase, Isoprene biosynthesis, Transferase; helical bundle, Protein Structure Initiative II (PSI II), Structural Genomics, NYSGXRC, 11257e, Transferase, New York SGX Research Center for Structural Genomics
Deposited on 2009-08-17, released 2009-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-29, with a file datestamp of 2015-04-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyltranstransferase
    Species: Methanosarcina mazei [TaxId:2209]
    Gene: MM_0789
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ipia_
  • Heterogens: MLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ipiA (A:)
    mslnieeweeyryveagikesitliedpglkkmvehvchsggkrirpiilllvseicsgs
    ysrslnaalavemmhsaslihddlldqglvrrnlpsapekfgpsgallcgdyliaksiaf
    ispygekviqdfgkagmdmaegevldlkledesfgendyfkciykktaslfaisasigay
    tggaeeelaerfshfgnalgtayqivddileflevvegkeskftsetlphiymkstskee
    alkksidcvklhvaaaketletfrecpardklfqitdyitvdmlenleghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ipiA (A:)
    nieeweeyryveagikesitliedpglkkmvehvchsggkrirpiilllvseicsgsysr
    slnaalavemmhsaslihddlldqglvrrnlpsapekfgpsgallcgdyliaksiafisp
    ygekviqdfgkagmdmaegevldlkendyfkciykktaslfaisasigaytggaeeelae
    rfshfgnalgtayqivddileflevvegetlphiymkstskeealkksidcvklhvaaak
    etletfrecpardklfqitdyitvdmle