PDB entry 3ilw

View 3ilw on RCSB PDB site
Description: Structure of DNA gyrase subunit A N-terminal domain
Class: isomerase
Keywords: DNA topology, topoisomerase, gyrase, antibiotic resistance, Mycobacterium tuberculosis, breakage-reunion domain, Structural Genomics, TB Structural Genomics Consortium, TBSGC, ATP-binding, DNA-binding, Isomerase, Nucleotide-binding
Deposited on 2009-08-07, released 2009-10-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.178
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase subunit A
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: gyrA, MT0006, MTCY10H4.04, Rv0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3ilwa_
  • Chain 'B':
    Compound: DNA gyrase subunit A
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: gyrA, MT0006, MTCY10H4.04, Rv0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3ilwb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ilwA (A:)
    snasvivgralpevrdglkpvhrrvlyamfdsgfrpdrshaksarsvaetmgnyhphgda
    siydslvrmaqpwslryplvdgqgnfgspgndppaamrytearltplamemlreideetv
    dfipnydgrvqeptvlpsrfpnllangsggiavgmatnipphnlreladavfwalenhda
    deeetlaavmgrvkgpdfptaglivgsqgtadayktgrgsirmrgvveveedsrgrtslv
    itelpyqvnhdnfitsiaeqvrdgklagisniedqssdrvglrivieikrdavakvvinn
    lykhtqlqtsfganmlaivdgvprtlrldqliryyvdhqldvivrrttyrlrkanerahi
    lrglvkaldaldevialirasetvdiaraglielldideiqaqaildmqlrrlaalerqr
    iiddlakieaeiadledilakperqrgivrdelaeivdrhgddrrtriia
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ilwA (A:)
    vgralpevrdglkpvhrrvlyamfdsgfrpdrshaksarsvaetmgnyhphgdasiydsl
    vrmaqpwslryplvdgqgnfgspgndppaamrytearltplamemlreideetvdfipny
    dgrvqeptvlpsrfpnllangsggiavgmatnipphnlreladavfwalenhdadeeetl
    aavmgrvkgpdfptaglivgsqgtadayktgrgsirmrgvveveedsrgrtslvitelpy
    qvnhdnfitsiaeqvrdgklagisniedqssdrvglrivieikrdavakvvinnlykhtq
    lqtsfganmlaivdgvprtlrldqliryyvdhqldvivrrttyrlrkanerahilrglvk
    aldaldevialirasetvdiaraglielldideiqaqaildmqlrrlaalerqriiddla
    kieaeiadledilakperqrgivrdelaeivdrhgddrrtriia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ilwB (B:)
    snasvivgralpevrdglkpvhrrvlyamfdsgfrpdrshaksarsvaetmgnyhphgda
    siydslvrmaqpwslryplvdgqgnfgspgndppaamrytearltplamemlreideetv
    dfipnydgrvqeptvlpsrfpnllangsggiavgmatnipphnlreladavfwalenhda
    deeetlaavmgrvkgpdfptaglivgsqgtadayktgrgsirmrgvveveedsrgrtslv
    itelpyqvnhdnfitsiaeqvrdgklagisniedqssdrvglrivieikrdavakvvinn
    lykhtqlqtsfganmlaivdgvprtlrldqliryyvdhqldvivrrttyrlrkanerahi
    lrglvkaldaldevialirasetvdiaraglielldideiqaqaildmqlrrlaalerqr
    iiddlakieaeiadledilakperqrgivrdelaeivdrhgddrrtriia
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ilwB (B:)
    gralpevrdglkpvhrrvlyamfdsgfrpdrshaksarsvaetmgnyhphgdasiydslv
    rmaqpwslryplvdgqgnfgspgndppaamrytearltplamemlreideetvdfipnyd
    grvqeptvlpsrfpnllangsggiavgmatnipphnlreladavfwalenhdadeeetla
    avmgrvkgpdfptaglivgsqgtadayktgrgsirmrgvveveedsrgrtslvitelpyq
    vnhdnfitsiaeqvrdgklagisniedqssdrvglrivieikrdavakvvinnlykhtql
    qtsfganmlaivdgvprtlrldqliryyvdhqldvivrrttyrlrkanerahilrglvka
    ldaldevialirasetvdiaraglielldideiqaqaildmqlrrlaalerqriiddlak
    ieaeiadledilakperqrgivrdelaeivdrhgddrrtriia