PDB entry 3ikz

View 3ikz on RCSB PDB site
Description: Crystal structure of phosphopantetheine adenylyltransferase from Burkholderia pseudomallei
Class: transferase
Keywords: NIAID, Infectious disease, SSGCID, Seattle Structural Genomics Center for Infectious Disease, human and animal pathogen, melioidosis, ATP-binding, Coenzyme A biosynthesis, Nucleotide-binding, Nucleotidyltransferase, Transferase
Deposited on 2009-08-06, released 2009-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Burkholderia pseudomallei 1710b [TaxId:320372]
    Gene: coaD, BURPS1710b_0748
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JW91 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d3ikza1, d3ikza2
  • Heterogens: COD, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ikzA (A:)
    gpgsmvvavypgtfdpltrghedlvrrassifdtlvvgvadsrakkpffsleerlkiane
    vlghypnvkvmgftgllkdfvrandarvivrglravsdfeyefqmagmnryllpdvetmf
    mtpsdqyqfisgtivreiaqlggdvskfvfpsvekwltekvaamaqgpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ikzA (A:)
    smvvavypgtfdpltrghedlvrrassifdtlvvgvadsrakkpffsleerlkianevlg
    hypnvkvmgftgllkdfvrandarvivrglrafeyefqmagmnryllpdvetmfmtpsdq
    yqfisgtivreiaqlggdvskfvfpsvekwltekvaama