PDB entry 3ikv

View 3ikv on RCSB PDB site
Description: Crystal structure of a Rex-family repressor R90D mutant from Thermus aquaticus
Class: DNA binding protein
Keywords: redox-sensing, winged helix, Rossmann fold, Nicotinamide Adenine Dinucleotide, NAD, Rex, Thermus aquaticus, Mutant, DNA BINDING PROTEIN, Cytoplasm, DNA-binding, Repressor, Transcription, Transcription regulation
Deposited on 2009-08-06, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-16, with a file datestamp of 2010-06-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.218
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Redox-sensing transcriptional repressor rex
    Species: Thermus thermophilus HB27 [TaxId:262724]
    Gene: rex, TT_C1293
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72I39 (1-206)
      • engineered (90)
    Domains in SCOPe 2.07: d3ikva1, d3ikva2
  • Chain 'B':
    Compound: Redox-sensing transcriptional repressor rex
    Species: Thermus thermophilus HB27 [TaxId:262724]
    Gene: rex, TT_C1293
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72I39 (Start-206)
      • engineered (90)
    Domains in SCOPe 2.07: d3ikvb1, d3ikvb2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ikvA (A:)
    gmkvpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrg
    vgytvpvlkrelrhilglnrkwglcivgmgdlgsaladypgfgesfelrgffdvdpekvg
    rpvrggviehvdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevp
    kevavenvdflagltrlsfailnpkwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ikvA (A:)
    mkvpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgv
    gytvpvlkrelrhilglnrkwglcivgmgdlgsaladypgfgesfelrgffdvdpekvgr
    pvrggviehvdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevpk
    evavenvdflagltrlsfailnpkwr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ikvB (B:)
    gmkvpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrg
    vgytvpvlkrelrhilglnrkwglcivgmgdlgsaladypgfgesfelrgffdvdpekvg
    rpvrggviehvdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevp
    kevavenvdflagltrlsfailnpkwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ikvB (B:)
    kvpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgvg
    ytvpvlkrelrhilglnrkwglcivgmgdlgsaladypgfgesfelrgffdvdpekvgrp
    vrggviehvdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevpke
    vavenvdflagltrlsfailnpkwr