PDB entry 3ikj

View 3ikj on RCSB PDB site
Description: Structural characterization for the nucleotide binding ability of subunit A mutant S238A of the A1AO ATP synthase
Class: hydrolase
Keywords: HYDROLASE, A-Type ATP synthase mutant
Deposited on 2009-08-06, released 2010-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: V-type ATP synthase alpha chain
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57728 (Start-239)
      • engineered (78)
      • engineered (237)
    • Uniprot O57728 (240-587)
    Domains in SCOPe 2.07: d3ikja1, d3ikja2, d3ikja3
  • Heterogens: MPD, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ikjA (A:)
    mvakgriirvtgplvvadgmkgakmyevvrvgelgligeiirlegdkaviqvyeetagvr
    pgepvvgtgaslsvelgprlltsiydgiqrplevirektgdfiargvtapalprdkkwhf
    ipkakvgdkvvggdiigevpetsiivhkimvppgiegeiveiaeegdytieeviakvktp
    sgeikelkmyqrwpvrvkrpykeklppevplitgqrvidtffpqakggtaaipgpfgagk
    tvtqhqlakwsdaqvviyigcgergnemtdvleefpklkdpktgkplmertvliantsnm
    pvaareasiytgitiaeyfrdmgydvalmadstsrwaealreisgrleempgeegypayl
    asklaefyeragrvvtlgsdyrvgsvsvigavsppggdfsepvvqntlrvvkvfwaldad
    larrrhfpainwltsyslyvdavkdwwhknidpewkamrdkamallqkeselqeivrivg
    pdalpereraillvarmlredylqqdafdevdtycppekqvtmmrvllnfydktmeainr
    gvpleeiaklpvreeigrmkferdvskirslidktneqfeelfkkyga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ikjA (A:)
    rpgepvvgtgaslsvelgprlltsiydgiqrplevirektgdfiargvtapalprdkkwh
    fipkakvgdkvvggdiigevpetsiivhkimvppgiegeiveiaeegdytieeviakvkt
    psgeikelkmyqrwpvrvkrpykeklppevplitgqrvidtffpqakggtaaipgpfgag
    ktvtqhqlakwsdaqvviyigcgergnemtdvleefpklkdpktgkplmertvliantsn
    mpvaareasiytgitiaeyfrdmgydvalmadstsrwaealpaylasklaefyeragrvv
    tlgsdyrvgsvsvigavsppggdfsepvvqntlrvvkvfwaldadlarrrhfpainwlts
    yslyvdavkdwwhknidpewkamrdkamallqkeselqeivrivgpdalpereraillva
    rmlredylqqdafdevdtycppekqvtmmrvllnfydktmeainrgvpleeiaklpvree
    igrmkferdvskirslidktneqfeelfkkyga