PDB entry 3ik4

View 3ik4 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF mandelate racemase/muconate lactonizing protein from Herpetosiphon aurantiacus
Class: isomerase
Keywords: structural genomics, enolase, epimerase, psi-2, protein structure initiative, new york sgx research center for structural genomics, nysgxrc, isomerase
Deposited on 2009-08-05, released 2009-08-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.219
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Herpetosiphon aurantiacus ATCC 23779 [TaxId:316274]
    Gene: Haur_1114
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9B055 (3-356)
      • expression tag (1-2)
      • expression tag (357-359)
    Domains in SCOPe 2.06: d3ik4a1, d3ik4a2, d3ik4a3, d3ik4a4
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Herpetosiphon aurantiacus ATCC 23779 [TaxId:316274]
    Gene: Haur_1114
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9B055 (3-356)
      • expression tag (1-2)
      • expression tag (357-358)
    Domains in SCOPe 2.06: d3ik4b1, d3ik4b2, d3ik4b3, d3ik4b4
  • Chain 'C':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Herpetosiphon aurantiacus ATCC 23779 [TaxId:316274]
    Gene: Haur_1114
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9B055 (3-356)
      • expression tag (1-2)
      • expression tag (357-358)
    Domains in SCOPe 2.06: d3ik4c1, d3ik4c2, d3ik4c3, d3ik4c4
  • Chain 'D':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Herpetosiphon aurantiacus ATCC 23779 [TaxId:316274]
    Gene: Haur_1114
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9B055 (3-356)
      • expression tag (1-2)
      • expression tag (357)
    Domains in SCOPe 2.06: d3ik4d1, d3ik4d2, d3ik4d3, d3ik4d4
  • Heterogens: K, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ik4A (A:)
    mslpttiqaisaeainlpltepfaiasgaqavaanvlvkvqladgtlglgeaapfpavsg
    etqtgtsaaierlqshllgadvrgwrklaamldhaeheaaaarcglemamldaltrhyhm
    plhvffggvskqletdmtitagdevhaaasakailargiksikvktagvdvaydlarlra
    ihqaaptaplivdgncgydveralafcaackaesipmvlfeqplpredwagmaqvtaqsg
    favaadesarsahdvlriaregtasviniklmkagvaeglkmiaiaqaaglglmiggmve
    silamsfsanlaagnggfdfidldtplfiaehpfiggfaqtggtlqladvaghgvnlegh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ik4A (A:)
    slpttiqaisaeainlpltepavaanvlvkvqladgtlglgeaapfpavsgetqtgtsaa
    ierlqshllgadvrgwrklaamldhaeheaaaarcglemamldaltrhyhmplhvffggv
    skqletdmtitagdevhaaasakailargiksikvktagvdvaydlarlraihqaaptap
    livdgncgydveralafcaackaesipmvlfeqplpredwagmaqvtaqsgfavaadesa
    rsahdvlriaregtasviniklmkagvaeglkmiaiaqaaglglmiggmvesilamsfsa
    nlaagnggfdfidldtplfiaehpfiggfaqtggtlqladvaghgvnlegh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ik4B (B:)
    mslpttiqaisaeainlpltepfaiasgaqavaanvlvkvqladgtlglgeaapfpavsg
    etqtgtsaaierlqshllgadvrgwrklaamldhaeheaaaarcglemamldaltrhyhm
    plhvffggvskqletdmtitagdevhaaasakailargiksikvktagvdvaydlarlra
    ihqaaptaplivdgncgydveralafcaackaesipmvlfeqplpredwagmaqvtaqsg
    favaadesarsahdvlriaregtasviniklmkagvaeglkmiaiaqaaglglmiggmve
    silamsfsanlaagnggfdfidldtplfiaehpfiggfaqtggtlqladvaghgvnlegh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ik4B (B:)
    slpttiqaisaeainlpltepfaiasgaqavaanvlvkvqladgtlglgeaapfpavsge
    tqtgtsaaierlqshllgadvrgwrklaamldhaeheaaaarcglemamldaltrhyhmp
    lhvffggvskqletdmtitagdevhaaasakailargiksikvktagvdvaydlarlrai
    hqaaptaplivdgncgydveralafcaackaesipmvlfeqplpredwagmaqvtaqsgf
    avaadesarsahdvlriaregtasviniklmkagvaeglkmiaiaqaaglglmiggmves
    ilamsfsanlaagnggfdfidldtplfiaehpfiggfaqtggtlqladvaghgvnleg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ik4C (C:)
    mslpttiqaisaeainlpltepfaiasgaqavaanvlvkvqladgtlglgeaapfpavsg
    etqtgtsaaierlqshllgadvrgwrklaamldhaeheaaaarcglemamldaltrhyhm
    plhvffggvskqletdmtitagdevhaaasakailargiksikvktagvdvaydlarlra
    ihqaaptaplivdgncgydveralafcaackaesipmvlfeqplpredwagmaqvtaqsg
    favaadesarsahdvlriaregtasviniklmkagvaeglkmiaiaqaaglglmiggmve
    silamsfsanlaagnggfdfidldtplfiaehpfiggfaqtggtlqladvaghgvnlegh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ik4C (C:)
    slpttiqaisaeainlplteavaanvlvkvqladgtlglgeaapfpavsgetqtgtsaai
    erlqshllgadvrgwrklaamldhaeheaaaarcglemamldaltrhyhmplhvffggvs
    kqletdmtitagdevhaaasakailargiksikvktagvdvaydlarlraihqaaptapl
    ivdgncgydveralafcaackaesipmvlfeqplpredwagmaqvtaqsgfavaadesar
    sahdvlriaregtasviniklmkagvaeglkmiaiaqaaglglmiggmvesilamsfsan
    laagnggfdfidldtplfiaehpfiggfaqtggtlqladvaghgvnleg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ik4D (D:)
    mslpttiqaisaeainlpltepfaiasgaqavaanvlvkvqladgtlglgeaapfpavsg
    etqtgtsaaierlqshllgadvrgwrklaamldhaeheaaaarcglemamldaltrhyhm
    plhvffggvskqletdmtitagdevhaaasakailargiksikvktagvdvaydlarlra
    ihqaaptaplivdgncgydveralafcaackaesipmvlfeqplpredwagmaqvtaqsg
    favaadesarsahdvlriaregtasviniklmkagvaeglkmiaiaqaaglglmiggmve
    silamsfsanlaagnggfdfidldtplfiaehpfiggfaqtggtlqladvaghgvnlegh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ik4D (D:)
    slpttiqaisaeainlplteavaanvlvkvqladgtlglgeaapfpavsgetqtgtsaai
    erlqshllgadvrgwrklaamldhaeheaaaarcglemamldaltrhyhmplhvffggvs
    kqletdmtitagdevhaaasakailargiksikvktagvdvaydlarlraihqaaptapl
    ivdgncgydveralafcaackaesipmvlfeqplpredwagmaqvtaqsgfavaadesar
    sahdvlriaregtasviniklmkagvaeglkmiaiaqaaglglmiggmvesilamsfsan
    laagnggfdfidldtplfiaehpfiggfaqtggtlqladvaghgvnle