PDB entry 3ii9

View 3ii9 on RCSB PDB site
Description: Crystal structure of glutaryl-coa dehydrogenase from Burkholderia pseudomallei at 1.73 Angstrom
Class: oxidoreductase
Keywords: SlipChip, Microfluidics, Screening, Optimization, protein crystallization, Structural Genomics, PSI-2, Protein Structure Initiative, Accelerated Technologies Center for Gene to 3D Structure, ATCG3D, FAD, Flavoprotein, Oxidoreductase, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2009-07-31, released 2009-12-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.172
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei 1710b [TaxId:320372]
    Gene: BURPS1710b_3237
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ii9a1, d3ii9a2
  • Chain 'B':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei 1710b [TaxId:320372]
    Gene: BURPS1710b_3237
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ii9b1, d3ii9b2
  • Chain 'C':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei 1710b [TaxId:320372]
    Gene: BURPS1710b_3237
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ii9c1, d3ii9c2
  • Chain 'D':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei 1710b [TaxId:320372]
    Gene: BURPS1710b_3237
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ii9d1, d3ii9d2
  • Heterogens: PEG, MG, PGE, PG4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ii9A (A:)
    smaaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremg
    eigllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaq
    kekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvf
    vvwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilph
    vkglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladm
    qteitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefg
    varhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ii9A (A:)
    aatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeig
    llgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkek
    ylpklatgewigcfgltepnsmvtrarkvpggyslsgskmwitnspiadvfvvwaklded
    grdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpft
    clnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlglq
    gvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgvarhlvnle
    vvntyegthdihalilgraqtgiqaff
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ii9B (B:)
    smaaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremg
    eigllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaq
    kekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvf
    vvwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilph
    vkglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladm
    qteitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefg
    varhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ii9B (B:)
    atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
    lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
    lpklatgewigcfgltepnhsmvtrarkvpggyslsgskmwitnspiadvfvvwaklded
    eirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpftcln
    sarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlglqgvl
    rlgrmkdegtaaveitsimkrnscgkaldiarlardmlggnggvarhlvnlevvntyegt
    hdihalilgraqtgiqaff
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ii9C (C:)
    smaaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremg
    eigllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaq
    kekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvf
    vvwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilph
    vkglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladm
    qteitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefg
    varhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ii9C (C:)
    atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
    lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
    lpklatgewigcfgltepnhgsmvtrarkvpggyslsgskmwitnspiadvfvvwaklde
    dgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpf
    tclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlgl
    qgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgvarhlvnl
    evvntyegthdihalilgraqtgiqaff
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ii9D (D:)
    smaaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremg
    eigllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaq
    kekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvf
    vvwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilph
    vkglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladm
    qteitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefg
    varhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ii9D (D:)
    aatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeig
    llgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkek
    ylpklatgewigcfgltepnpgsmvtrarkvpggyslsgskmwitnspiadvfvvwakld
    edgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgp
    ftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlg
    lqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngefgvarhlvnlev
    vntyegthdihalilgraqtgiqaff