PDB entry 3ihy

View 3ihy on RCSB PDB site
Description: Human PIK3C3 crystal structure
Class: transferase
Keywords: Alpha/Beta protein, Structural Genomics, SGC Stockholm, Structural Genomics Consortium, SGC, ATP-binding, Kinase, Manganese, Nucleotide-binding, Phosphoprotein, Transferase
Deposited on 2009-07-31, released 2009-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-13, with a file datestamp of 2009-10-09.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.19
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 3-kinase catalytic subunit type 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3C3, PIK3C3A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NEB9 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d3ihya1, d3ihya2
  • Chain 'B':
    Compound: Phosphatidylinositol 3-kinase catalytic subunit type 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3C3, PIK3C3A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NEB9 (2-End)
      • expression tag (1)
  • Chain 'C':
    Compound: Phosphatidylinositol 3-kinase catalytic subunit type 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3C3, PIK3C3A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NEB9 (2-End)
      • expression tag (0-1)
  • Chain 'D':
    Compound: Phosphatidylinositol 3-kinase catalytic subunit type 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3C3, PIK3C3A
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Phosphatidylinositol 3-kinase catalytic subunit type 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3C3, PIK3C3A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NEB9 (2-End)
      • expression tag (0-1)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ihyA (A:)
    smsdhdlkpnaatrdqlniivsypptkqltyeeqdlvwkfryyltnqekaltkflkcvnw
    dlpqeakqalellgkwkpmdvedslellsshytnptvrryavarlrqaddedllmyllql
    vqalkyenfddikngleptkkdsqssvsenvsnsginsaeidssqiitsplpsvsspppa
    sktkevpdgenleqdlctflisracknstlanylywyvivecedqdtqqrdpkthemyln
    vmrrfsqallkgdksvrvmrsllaaqqtfvdrlvhlmkavqresgnrkkknerlqallgd
    nekmnlsdveliplplepqvkirgiipetatlfksalmpaqlffktedggkypvifkhgd
    dlrqdqlilqiislmdkllrkenldlkltpykvlatstkhgfmqfiqsvpvaevldtegs
    iqnffrkyapsengpngisaevmdtyvkscagycvityilgvgdrhldnllltktgklfh
    idfgyilgrdpkplpppmklnkemvegmggtqseqyqefrkqcytaflhlrrysnlilnl
    fslmvdanipdialepdktvkkvqdkfrldlsdeeavhymqslidesvhalfaavveqih
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ihyA (A:)
    msdhdlkpnaatrdqlniivsypptkqltyeeqdlvwkfryyltnqekaltkflkcvnwd
    lpqeakqalellgkwkpmdvedslellsshytnptvrryavarlrqaddedllmyllqlv
    qalkyenfddiknglleqdlctflisracknstlanylywyvivecedqdtqqrdpkthe
    mylnvmrrfsqallkgdksvrvmrsllaaqqtfvdrlvhlmkavqresgnrkkknerlqa
    llgdnekmnlsdveliplplepqvkirgiipetatlfksalmpaqlffktedggkypvif
    khgddlrqdqlilqiislmdkllrkenldlkltpykvlatstkhgfmqfiqsvpvaevld
    tegsiqnffrkyapsengpngisaevmdtyvkscagycvityilgvgdrhldnllltktg
    klfhidfgyilgrdpkplpppmklnkemvegmggtqseqyqefrkqcytaflhlrrysnl
    ilnlfslmvdanipdialepdktvkkvqdkfrldlsdeeavhymqslidesvhalf
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.