PDB entry 3ihw

View 3ihw on RCSB PDB site
Description: Crystal structure of the Ras-like domain of CENTG3
Class: signaling protein
Keywords: ras, centaurin, gtpase, Structural Genomics, Structural Genomics Consortium, sgc, Alternative splicing, ANK repeat, Cytoplasm, GTP-binding, GTPase activation, Metal-binding, Nucleotide-binding, Phosphoprotein, Zinc, Zinc-finger, SIGNALING PROTEIN
Deposited on 2009-07-30, released 2009-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: centg3
    Species: Homo sapiens [TaxId:9606]
    Gene: AGAP3, CENTG3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96P47 (18-End)
      • expression tag (15-17)
    Domains in SCOPe 2.07: d3ihwa1, d3ihwa2
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ihwA (A:)
    mhhhhhhssgrenlyfqgpelkvgivgnlssgksalvhryltgtyvqeespeggrfkkei
    vvdgqsylllirdeggppelqfaawvdavvfvfsledeisfqtvynyflrlcsfrnasev
    pmvlvgtqdaisaanprviddsrarklstdlkrctyyetcatyglnvervfqdvaqkvva
    lrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ihwA (A:)
    fqgpelkvgivgnlssgksalvhryltgtyvqeespeggrfkkeivvdgqsylllirdeg
    gppelqfaawvdavvfvfsledeisfqtvynyflrlcsfrnasevpmvlvgtqdaisaan
    prviddsrarklstdlkrctyyetcatyglnvervfqdvaqkvvalr