PDB entry 3ih1

View 3ih1 on RCSB PDB site
Description: Crystal structure of carboxyvinyl-carboxyphosphonate phosphorylmutase from Bacillus anthracis
Class: lyase
Keywords: alpha-beta structure, TIM-barrel, Center for Structural Genomics of Infectious Diseases, Lyase, CSGID
Deposited on 2009-07-29, released 2009-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.146
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylisocitrate lyase
    Species: Bacillus anthracis str. [TaxId:261594]
    Gene: BAS2190, BA_2350, GBAA2350, GBAA_2350, prpB, yqiQ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ih1a_
  • Chain 'B':
    Compound: Methylisocitrate lyase
    Species: Bacillus anthracis str. [TaxId:261594]
    Gene: BAS2190, BA_2350, GBAA2350, GBAA_2350, prpB, yqiQ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ih1b_
  • Heterogens: PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ih1A (A:)
    snamawvvnkqstqeelanrfralveaneilqipgahdamaalvarntgflalylsgaay
    taskglpdlgivtstevaerardlvratdlpvlvdidtgfggvlnvartavemveakvaa
    vqiedqqlpkkcghlngkklvtteelvqkikaikevapslyivartdargvegldeaier
    anayvkagadaifpealqseeefrlfnskvnapllanmtefgktpyysaeefanmgfqmv
    iypvtslrvaakayenvftliketgsqkdalsnmqtrselyetisyhdfeeldtgiaktv
    lsedq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ih1A (A:)
    nkqstqeelanrfralveaneilqipgahdamaalvarntgflalylsgaaytaskglpd
    lgivtstevaerardlvratdlpvlvdidtgfggvlnvartavemveakvaavqiedqql
    pkkcghlngkklvtteelvqkikaikevapslyivartdargvegldeaieranayvkag
    adaifpealqseeefrlfnskvnapllanmtefgktpyysaeefanmgfqmviypvtslr
    vaakayenvftliketgsqkdalsnmqtrselyetisyhdfeeldtgiak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ih1B (B:)
    snamawvvnkqstqeelanrfralveaneilqipgahdamaalvarntgflalylsgaay
    taskglpdlgivtstevaerardlvratdlpvlvdidtgfggvlnvartavemveakvaa
    vqiedqqlpkkcghlngkklvtteelvqkikaikevapslyivartdargvegldeaier
    anayvkagadaifpealqseeefrlfnskvnapllanmtefgktpyysaeefanmgfqmv
    iypvtslrvaakayenvftliketgsqkdalsnmqtrselyetisyhdfeeldtgiaktv
    lsedq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ih1B (B:)
    qstqeelanrfralveaneilqipgahdamaalvarntgflalylsgaaytaskglpdlg
    ivtstevaerardlvratdlpvlvdidtgfggvlnvartavemveakvaavqiedqqlpk
    kcghlngkklvtteelvqkikaikevapslyivartdargvegldeaieranayvkagad
    aifpealqseeefrlfnskvnapllanmtefgktpyysaeefanmgfqmviypvtslrva
    akayenvftliketgsqkdalsnmqtrselyetisyhdfeeldtgiakt