PDB entry 3ifz

View 3ifz on RCSB PDB site
Description: crystal structure of the first part of the Mycobacterium tuberculosis DNA gyrase reaction core: the breakage and reunion domain at 2.7 A resolution
Class: isomerase
Keywords: DNA gyrase, GyrA, Breakage and reunion domain, Type II topoisomerase, tuberculosis, quinolone binding site, DNA binding site, Antibiotic resistance, ATP-binding, DNA-binding, Isomerase, Nucleotide-binding, Topoisomerase
Deposited on 2009-07-27, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase subunit A
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: gyrA, MT0006, MTCY10H4.04, Rv0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ifza_
  • Chain 'B':
    Compound: DNA gyrase subunit A
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: gyrA, MT0006, MTCY10H4.04, Rv0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ifzb_
  • Heterogens: MPD, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ifzA (A:)
    mtdttlppddsldriepvdieqemqrsyidyamsvivgralpevrdglkpvhrrvlyamf
    dsgfrpdrshaksarsvaetmgnyhphgdasiydslvrmaqpwslryplvdgqgnfgspg
    ndppaamrytearltplamemlreideetvdfipnydgrvqeptvlpsrfpnllangsgg
    iavgmatnipphnlreladavfwalenhdadeeetlaavmgrvkgpdfptaglivgsqgt
    adayktgrgsirmrgvveveedsrgrtslvitelpyqvnhdnfitsiaeqvrdgklagis
    niedqssdrvglrivieikrdavakvvinnlykhtqlqtsfganmlaivdgvprtlrldq
    liryyvdhqldvivrrttyrlrkanerahilrglvkaldaldevialirasetvdiarag
    lielldideiqaqaildmqlrrlaalerqriiddlakieaeiadledilakperqrgivr
    delaeivdrhgddrrtriiaaehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifzA (A:)
    ddsldriepvdieqemqrsyidyamsvivgralpevrdglkpvhrrvlyamfdsgfrpdr
    shaksarsvaetmgnyhphgdasiydslvrmaqpwslryplvdgqgnfgspgndppaamr
    ytearltplamemlreideetvdfipnydgrvqeptvlpsrfpnllangsggiavgmatn
    ipphnlreladavfwalenhdadeeetlaavmgrvkgpdfptaglivgsqgtadayktgr
    gsirmrgvveveedsrlvitelpyqvnhdnfitsiaeqvrdgklagisniedqssdrvgl
    rivieikrdavakvvinnlykhtqlqtsfganmlaivdgvprtlrldqliryyvdhqldv
    ivrrttyrlrkanerahilrglvkaldaldevialirasetvdiaraglielldideiqa
    qaildmqlrrlaalerqriiddlakieaeiadledilakperqrgivrdelaeivdrhgd
    drrtrii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ifzB (B:)
    mtdttlppddsldriepvdieqemqrsyidyamsvivgralpevrdglkpvhrrvlyamf
    dsgfrpdrshaksarsvaetmgnyhphgdasiydslvrmaqpwslryplvdgqgnfgspg
    ndppaamrytearltplamemlreideetvdfipnydgrvqeptvlpsrfpnllangsgg
    iavgmatnipphnlreladavfwalenhdadeeetlaavmgrvkgpdfptaglivgsqgt
    adayktgrgsirmrgvveveedsrgrtslvitelpyqvnhdnfitsiaeqvrdgklagis
    niedqssdrvglrivieikrdavakvvinnlykhtqlqtsfganmlaivdgvprtlrldq
    liryyvdhqldvivrrttyrlrkanerahilrglvkaldaldevialirasetvdiarag
    lielldideiqaqaildmqlrrlaalerqriiddlakieaeiadledilakperqrgivr
    delaeivdrhgddrrtriiaaehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifzB (B:)
    idyamsvivgralpevrdglkpvhrrvlyamfdsgfrpdrshaksarsvaetmgnyhphg
    dasiydslvrmaqpwslryplvdgqgnfgspgndppaamrytearltplamemlreidee
    tvdfipnydgrvqeptvlpsrfpnllangsggiavgmatnipphnlreladavfwalenh
    dadeeetlaavmgrvkgpdfptaglivgsqgtadayktgrgsirmrgvveveedsrgrts
    lvitelpyqvnhdnfitsiaeqvrdgklagisniedqssdrvglrivieikrdavakvvi
    nnlykhtqlqtsfganmlaivdgvprtlrldqliryyvdhqldvivrrttyrlrkanera
    hilrglvkaldaldevialirasetvdiaraglielldideiqaqaildmqlrrlaaler
    qriiddlakieaeiadledilakperqrgivrdelaeivdrhgddrrtriiaa