PDB entry 3ifh

View 3ifh on RCSB PDB site
Description: Crystal structure of succinate-semialdehyde dehydrogenase from Burkholderia pseudomallei, part 2 of 2
Class: oxidoreductase
Keywords: NIAID, Infectious Disease, SSGCID, Seattle Structural Genomics Center for Infectious Disease, Non-crystallographic symmetry, NCS, Oxidoreductase
Deposited on 2009-07-24, released 2009-08-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.238
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.03: d3ifh1_
  • Chain '2':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.03: d3ifh2_
  • Chain '3':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.03: d3ifh3_
  • Chain '4':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.03: d3ifh4_
  • Chain '5':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.03: d3ifh5_
  • Chain '6':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.03: d3ifh6_
  • Chain 'Q':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.03: d3ifhq_
  • Chain 'R':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.03: d3ifhr_
  • Chain 'S':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.03: d3ifhs_
  • Chain 'T':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.03: d3ifht_
  • Chain 'U':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.03: d3ifhu_
  • Chain 'V':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.03: d3ifhv_
  • Chain 'W':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.03: d3ifhw_
  • Chain 'X':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.03: d3ifhx_
  • Chain 'Y':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.03: d3ifhy_
  • Chain 'Z':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.03: d3ifhz_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >3ifh1 (1:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifh1 (1:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >3ifh2 (2:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifh2 (2:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >3ifh3 (3:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifh3 (3:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >3ifh4 (4:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifh4 (4:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >3ifh5 (5:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifh5 (5:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain '6':
    Sequence, based on SEQRES records: (download)
    >3ifh6 (6:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifh6 (6:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3ifhQ (Q:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifhQ (Q:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3ifhR (R:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifhR (R:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3ifhS (S:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifhS (S:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3ifhT (T:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifhT (T:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3ifhU (U:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifhU (U:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3ifhV (V:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifhV (V:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3ifhW (W:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifhW (W:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3ifhX (X:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifhX (X:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3ifhY (Y:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifhY (Y:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >3ifhZ (Z:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifhZ (Z:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av