PDB entry 3ifg

View 3ifg on RCSB PDB site
Description: Crystal structure of succinate-semialdehyde dehydrogenase from Burkholderia pseudomallei, part 1 of 2
Class: oxidoreductase
Keywords: NIAID,.Infectious Disease, SSGCID, Seattle Structural Genomics Center for Infectious Disease, Non-crystallographic symmetry, NCS, Oxidoreductase
Deposited on 2009-07-24, released 2009-08-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.238
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.05: d3ifga_
  • Chain 'B':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.05: d3ifgb_
  • Chain 'C':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.05: d3ifgc_
  • Chain 'D':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.05: d3ifgd_
  • Chain 'E':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.05: d3ifge_
  • Chain 'F':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.05: d3ifgf_
  • Chain 'G':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.05: d3ifgg_
  • Chain 'H':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.05: d3ifgh_
  • Chain 'I':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.05: d3ifgi_
  • Chain 'J':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.05: d3ifgj_
  • Chain 'K':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.05: d3ifgk_
  • Chain 'L':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.05: d3ifgl_
  • Chain 'M':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.05: d3ifgm_
  • Chain 'N':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.05: d3ifgn_
  • Chain 'O':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.05: d3ifgo_
  • Chain 'P':
    Compound: Succinate-semialdehyde dehydrogenase (NADP+)
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: gabD, BURPS1710b_2207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JS51 (4-483)
      • expression tag (2-3)
    Domains in SCOPe 2.05: d3ifgp_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ifgA (A:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifgA (A:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ifgB (B:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifgB (B:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ifgC (C:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifgC (C:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ifgD (D:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifgD (D:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ifgE (E:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifgE (E:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ifgF (F:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifgF (F:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ifgG (G:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifgG (G:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ifgH (H:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifgH (H:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3ifgI (I:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifgI (I:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3ifgJ (J:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifgJ (J:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3ifgK (K:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifgK (K:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3ifgL (L:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifgL (L:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3ifgM (M:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifgM (M:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3ifgN (N:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifgN (N:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3ifgO (O:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifgO (O:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3ifgP (P:)
    gpgsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaq
    aawagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiew
    faeegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpiv
    vkpaestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavg
    rllmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvh
    ervydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtgg
    krhalghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaayl
    ysrdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikyl
    cvav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ifgP (P:)
    gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
    wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
    eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
    paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
    lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
    vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
    halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
    rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
    av