PDB entry 3if1

View 3if1 on RCSB PDB site
Description: Crystal structure of 237mAb in complex with a GalNAc
Class: immune system
Keywords: glycopepitde, antibody, Fab, carbohydrate-biding, tumour, IMMUNE SYSTEM
Deposited on 2009-07-23, released 2010-06-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.228
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin light chain (IgG2a)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IF1 (0-214)
    Domains in SCOPe 2.06: d3if1a1, d3if1a2
  • Chain 'B':
    Compound: Immunoglobulin heavy chain (IgG2a)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IF1 (0-216)
  • Chain 'C':
    Compound: Immunoglobulin light chain (IgG2a)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IF1 (0-214)
    Domains in SCOPe 2.06: d3if1c1, d3if1c2
  • Chain 'D':
    Compound: Immunoglobulin heavy chain (IgG2a)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IF1 (0-216)
  • Heterogens: ZN, MG, NGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3if1A (A:)
    iqltqsplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrfs
    gvpdrfsgsgsgtdftlkissveaedlgvyfcsqsthvptfgggtkleikradaaptvsi
    fppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmss
    tltltkdeyerhnsytceathktstspivksfnre
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3if1C (C:)
    iqltqsplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrfs
    gvpdrfsgsgsgtdftlkissveaedlgvyfcsqsthvptfgggtkleikradaaptvsi
    fppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmss
    tltltkdeyerhnsytceathktstspivksfnre
    

  • Chain 'D':
    No sequence available.