PDB entry 3iea

View 3iea on RCSB PDB site
Description: Structure of reduced M98L mutant of amicyanin
Class: electron transport
Keywords: TYPE-I BLUE COPPER PROTEIN; BETA SANDWICH, ELECTRON TRANSPORT, Copper, Metal-binding, Periplasm, Transport
Deposited on 2009-07-22, released 2009-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: amicyanin
  Species: Paracoccus denitrificans [TaxId:266]
  Gene: ami, mauC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22364 (0-104)
    • engineered (97)
  Domains in SCOPe 2.08: d3ieaa_
• Heterogens: PO4, CU, ZN, CL, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3ieaA (A:)
  dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
  vlgeaalkgpmmkkeqaysltfteagtydyhctphpflrgkvvve