PDB entry 3ie5

View 3ie5 on RCSB PDB site
Description: Crystal structure of Hyp-1 protein from Hypericum perforatum (St John's wort) involved in hypericin biosynthesis
Class: Plant Protein, BIOSYNTHETIC PROTEIN
Keywords: hypericin, St John's wort, depression, allergy, PR-10 protein, cytokinin, plant hormones, polyethylene glycol, PEG, Pathogenesis-related protein, Plant defense, Plant Protein, BIOSYNTHETIC PROTEIN
Deposited on 2009-07-22, released 2009-11-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.172
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenolic oxidative coupling protein Hyp-1
    Species: Hypericum perforatum [TaxId:65561]
    Gene: hyp-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8H1L1 (6-164)
      • expression tag (5)
      • see remark 999 (19)
      • see remark 999 (91)
      • see remark 999 (124)
    Domains in SCOPe 2.06: d3ie5a1, d3ie5a2
  • Chain 'B':
    Compound: Phenolic oxidative coupling protein Hyp-1
    Species: Hypericum perforatum [TaxId:65561]
    Gene: hyp-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8H1L1 (6-164)
      • expression tag (1-5)
      • see remark 999 (19)
      • see remark 999 (91)
      • see remark 999 (124)
    Domains in SCOPe 2.06: d3ie5b1, d3ie5b2
  • Heterogens: CL, PGE, PG4, PE8, 1PE, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ie5A (A:)
    gidpftmaaytivkeeespiaphrlfkalvlerhqvlvkaqphvfksgeiiegdggvgtv
    tkitfvdghpltymlhkfdeidaanfyckytlfegdvlrdniekvvyevkleavgggskg
    kitvtyhpkpgctvneeevkigekkayefykqveeylaanpevfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ie5A (A:)
    tmaaytivkeeespiaphrlfkalvlerhqvlvkaqphvfksgeiiegdggvgtvtkitf
    vdghpltymlhkfdeidaanfyckytlfegdvlrdniekvvyevkleavgggskgkitvt
    yhpkpgctvneeevkigekkayefykqveeylaanpevfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ie5B (B:)
    gidpftmaaytivkeeespiaphrlfkalvlerhqvlvkaqphvfksgeiiegdggvgtv
    tkitfvdghpltymlhkfdeidaanfyckytlfegdvlrdniekvvyevkleavgggskg
    kitvtyhpkpgctvneeevkigekkayefykqveeylaanpevfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ie5B (B:)
    idpftmaaytivkeeespiaphrlfkalvlerhqvlvkaqphvfksgeiiegdggvgtvt
    kitfvdghpltymlhkfdeidaanfyckytlfegdvlrdniekvvyevkleavgggskgk
    itvtyhpkpgctvneeevkigekkayefykqveeylaanpevfa