PDB entry 3idm

View 3idm on RCSB PDB site
Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 Fab' fragment in complex with gp41 Peptide analog ELD(Nrg)WAS
Class: immune system
Keywords: HIV-1, gp41, MPER, 2F5, IMMUNE SYSTEM
Deposited on 2009-07-21, released 2010-02-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2F5 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IDM (0-213)
    Domains in SCOPe 2.08: d3idma1, d3idma2
  • Chain 'B':
    Compound: 2F5 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3IDM (0-End)
  • Chain 'C':
    Compound: gp41 MPER peptide analog
    Database cross-references and differences (RAF-indexed):
    • PDB 3IDM (0-6)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3idmA (A:)
    alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
    rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvrrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyecevthqglsspvtksfnrgec
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.