PDB entry 3ida

View 3ida on RCSB PDB site
Description: Thermostable Cocaine Esterase with mutations L169K and G173Q, bound to DTT adduct
Class: hydrolase
Keywords: alpha/beta hydrolase, esterase, Hydrolase
Deposited on 2009-07-20, released 2010-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.177
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cocaine esterase
    Species: Rhodococcus sp. [TaxId:51612]
    Gene: cocE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L9D7 (Start-573)
      • engineered (168)
      • engineered (172)
      • expression tag (574)
    Domains in SCOPe 2.07: d3idaa1, d3idaa2, d3idaa3
  • Heterogens: CL, DBC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3idaA (A:)
    mvdgnysvasnvmvpmrdgvrlavdlyrpdadgpvpvllvrnpydkfdvfawstqstnwl
    efvrdgyavviqdtrglfasegefvphvddeadaedtlswileqawcdgnvgmfgvsylg
    vtqwqaavsgvgglkaiapsmasadlyrapwygpggalsveallgwsakigtqlitsrsd
    arpedaadfvqlaailndvagaasvtplaeqpllgrlipwvidqvvdhpdndeswqsisl
    ferlgglatpalitagwydgfvgeslrtfvavkdnadarlvvgpwshsnltgrnadrkfg
    iaatypiqeattmhkaffdrhlrgetdalagvpkvrlfvmgidewrdetdwplpdtaytp
    fylggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhngdngpadqrp
    ihdrddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdgraialcdgi
    vrmryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpkydrnsntgg
    viareqleemctavnrihrgpehpshivlpiikrklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3idaA (A:)
    gnysvasnvmvpmrdgvrlavdlyrpdadgpvpvllvrnpydkfdvfawstqstnwlefv
    rdgyavviqdtrglfasegefvphvddeadaedtlswileqawcdgnvgmfgvsylgvtq
    wqaavsgvgglkaiapsmasadlyrapwygpggalsveallgwsakigtqlitsrsdarp
    edaadfvqlaailndvagaasvtplaeqpllgrlipwvidqvvdhpdndeswqsislfer
    lgglatpalitagwydgfvgeslrtfvavkdnadarlvvgpwshsnltgrnadrkfgiaa
    typiqeattmhkaffdrhlrgetdalagvpkvrlfvmgidewrdetdwplpdtaytpfyl
    ggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhngdngpadqrpihd
    rddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdgraialcdgivrm
    ryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpkydrnsntggvia
    reqleemctavnrihrgpehpshivlpiikrk