PDB entry 3icn

View 3icn on RCSB PDB site
Description: Trypanosoma cruzi farnesyl diphosphate synthase homodimer in complex with isopentenyl pyrophosphate and 3-Fluoro-1-(2-hydroxy-2,2-bis-phosphono-ethyl)-pyridinium
Class: transferase
Keywords: farnesyl diphosphate synthase, FPPS, bisphosphonate, zoledronate, risedronate, minodronate, Chagas disease, Isoprene biosynthesis, Transferase
Deposited on 2009-07-17, released 2010-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: farnesyl pyrophosphate synthase
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: FPPS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3icna_
  • Heterogens: NI9, MG, SO4, IPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3icnA (A:)
    masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae
    gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt
    tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl
    dpevaqpmttdfaeftpaiykrivkykttfytyllplvmglfvseaaasvemnlvervah
    ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygdk
    dpakvavvkrlyseanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr
    kk