PDB entry 3ibd

View 3ibd on RCSB PDB site
Description: Crystal structure of a cytochrome P450 2B6 genetic variant in complex with the inhibitor 4-(4-chlorophenyl)imidazole
Class: Oxidoreductase/Oxidoreductase Inhibitor
Keywords: P450, cytochrome P450 2B6, monooxygenase, oxidoreductase, membrane protein, CYP 2B6, Endoplasmic reticulum, Heme, Iron, Membrane, Metal-binding, Microsome, Phosphoprotein, Oxidoreductase-Oxidoreductase Inhibitor complex
Deposited on 2009-07-15, released 2010-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 2B6
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2B6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20813 (10-471)
      • expression tag (8-9)
      • engineered (206)
      • engineered (242)
      • expression tag (472)
    Domains in SCOPe 2.07: d3ibda1, d3ibda2, d3ibda3
  • Heterogens: HEM, CPZ, CM5, SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ibdA (A:)
    makktsskgklppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlc
    gveairealvdkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdfgmgk
    rsveeriqeeaqclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkml
    nlfyqtfslissvfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldps
    aprdlidtyllhmekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyph
    vaervyreieqvigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrg
    yiipkdtevflilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclge
    giaraelflffttilqnfsmaspvapedidltpqecgvgkipptyqirflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ibdA (A:)
    gklppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlcgveairea
    lvdkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdfgmgkrsveeriq
    eeaqclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkmlnlfyqtfs
    lissvfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldpsaprdlidt
    yllhmekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyphvaervyre
    ieqvigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrgyiipkdte
    vflilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclgegiaraelf
    lffttilqnfsmaspvapedidltpqecgvgkipptyqirflprh